KEGG   Rhizobium pusense IRBG74: BN877_I1466
Entry
BN877_I1466       CDS       T02867                                 

Definition
(GenBank) putative Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I1466
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rir01002]
    BN877_I1466
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I1466
Enzymes [BR:rir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN877_I1466
Peptidases and inhibitors [BR:rir01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BN877_I1466
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BN877_I1466
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Other DBs
NCBI-ProteinID: CDI08373
UniProt: U4PTI0
LinkDB
Position
1427499..1428713
AA seq 404 aa
MAGGRLWQTALGGFMRKTFHRSYLSAVAAAAFAFLSAGAAQSQTAPFIAKAEQAYMIDAE
TGTVLLAQNEDQSFPPASLAKLMTVEVVLDALSRGQLASETVYPVSEYAWRTGGAPSRTS
TMFAALKSSVGINDLLTGIIVQNANDGCIIIAEGMAGSDAAFAKRMTARAGELGMNRSTF
ANSTGLPDSGNQTTARDMVRLAQHLHDTYPDRYSLFTKPDFEWNRIFQRNKNTLLMPGSG
IDGLGLGFAEGSGFAAVVSAEREGRRIYLALAGIADDKTRQEEARRVVDWGLTAFEKRRL
FSKDEVVGSVSVYGGDASYVDLSPKDDVSVLVPVNNPERLSGRIVYRWPLNAPLDVGANA
GTLKIFSGERLLREVPLYTKSRVNKGSLTQNAAGALKELLLFWL
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggcgggtggccggttgtggcagacagcactgggcggtttcatgcgcaagacctttcat
cgctcctatctgtcggccgtcgcggcggccgcttttgcatttttgagcgccggcgcggcg
caatcgcagacagcgcccttcatcgctaaggccgagcaggcctatatgatcgatgccgaa
accggtacggtgcttcttgcccaaaatgaggatcagtcctttccgcccgcatcacttgcc
aagctgatgacggtggaggtggtgctggatgcgctgtcgagaggacagctggcgtcggaa
acggtctatcccgtttcggaatatgcctggcgcacgggcggggccccatcgcgaacgtca
accatgttcgccgccctcaaatcctccgttggcatcaatgaccttttgaccggaatcatc
gtgcagaacgccaatgacggctgcatcatcatcgccgaaggcatggcgggatcggacgct
gcctttgccaagcgcatgacggcacgggccggcgaacttggcatgaaccgcagcacgttt
gccaattccaccggacttcccgattccggaaaccagacgaccgccagggacatggtgcgc
cttgcccagcatctgcatgacacctatcccgaccgctactcgttgtttacgaagccggac
ttcgaatggaaccggattttccagcgcaacaagaacacgttgctgatgccgggaagcggt
atagacggtcttggcctcggttttgcagaaggcagcggttttgccgccgtggtttcggcg
gagcgggaagggcgccgcatctatctggcgcttgccggcatcgcagacgacaagacgcgg
caggaggaagcgcgcagagtggtggactggggcctgaccgccttcgaaaaacgccgcctg
ttcagcaaggatgaagtggttggctccgtcagcgtgtatggcggcgatgcctcctatgtc
gacctttctccgaaggacgatgtcagcgtcctggtgcccgtcaacaatccggaacgcctc
tccggacgtatcgtctatcgctggccgctgaacgcgccgctcgatgtcggggcgaatgcc
ggaacgctgaagatattctcgggcgagcgtctattgcgcgaagtgccgctctatacgaag
agccgggtgaacaagggttcgctcacccagaatgccgcaggagcattgaaggaacttctg
ctgttctggctgtga

KEGG   Rhizobium pusense IRBG74: BN877_I2407
Entry
BN877_I2407       CDS       T02867                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2407
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rir01002]
    BN877_I2407
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2407
Enzymes [BR:rir01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BN877_I2407
Peptidases and inhibitors [BR:rir01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BN877_I2407
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BN877_I2407
SSDB
Motif
Pfam: Peptidase_S11 SPOR Beta-lactamase2 Peptidase_S13
Other DBs
NCBI-ProteinID: CDI09296
UniProt: U4Q9S7
LinkDB
Position
2296539..2297819
AA seq 426 aa
MSGMIKRGMAGAWIFALAFFCAILSLHASPAQAGYAHFIMDANTGKVLAARNADVLNHPA
SLTKMMTLYLTFEALHAGKLRWDQKITMSKNGASVIPSKLYVRQGQTFTVREAVYGMIVK
SANDMAEGMGDHLGGSEARFAEMMTRKARQLGMTKTVFRNASGLPNKSQVTTARDMAKLG
LALQRDFPKEYSLFATQSFNFRGKRIRGHNNLMYRYQGMDGIKTGYTNASGFNLVSAVNH
NGRRVVGVVLGGKTARSRDAQMAALLDKAVPQASRGRNTEQLVASANVSRTFDVAAAVPL
PMFAERRADPVAMQIATANADVADMMQVSAIPRPAPAAAPSGQRSRWEVQIAATDSEAAA
RSLLANARSNIGNYSGIAPYTEAVQSGSATLYRARFTGFEDQSSAVSACKALKARSYACV
VMTSEG
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtcgggaatgatcaaacggggaatggcgggtgcctggatttttgcactcgccttcttt
tgcgcgatcctctcgctccatgcgtcgccggcgcaggcgggctatgcccatttcatcatg
gacgccaataccggcaaggttctggccgcccgcaatgccgatgtgctgaaccaccccgcc
tcgctcaccaagatgatgacgctttacctgacctttgaggcgctgcatgccggcaaactt
cgctgggaccagaagataaccatgtccaagaatggggcatcggtcatcccctcgaagctc
tatgtgcgtcagggccagaccttcaccgtgcgcgaagccgtctacggcatgatcgtcaaa
tccgccaatgacatggccgaaggtatgggcgatcacctcggcggctcagaggcacggttc
gccgaaatgatgacccgcaaggcccgccagctcggcatgaccaaaacggtcttccgcaac
gcgtccggcctgcccaacaagtcgcaggtgacgacggcacgcgacatggcgaagctcggt
cttgccttgcaacgggattttcccaaagaatacagcctcttcgccacgcaatccttcaat
tttcgtggaaagcgcatccgtggccacaacaatctgatgtaccgttatcaggggatggac
ggcatcaagaccggctataccaacgcctccggcttcaatctcgtcagtgcagtcaatcac
aatggccgccgcgtcgtcggcgtcgtgctgggcggcaagaccgcgcgcagccgcgatgcc
cagatggctgcacttctcgacaaggccgtgccgcaggcatcgagaggccgcaacaccgaa
cagctcgtcgccagtgccaatgtcagccgcaccttcgatgttgccgccgccgtgccgctg
ccgatgttcgccgagcgccgggcagatccggttgcaatgcagattgccaccgcaaacgcc
gatgtggcggacatgatgcaggtctcggccatcccgcggcctgctcccgccgcggcccct
tccggccagcgcagccggtgggaagtgcagatcgccgccaccgacagcgaagccgccgcc
cgctcgctgctcgccaatgcgcgctccaatatcggcaactattccggcatcgccccctac
accgaagccgtgcagagcggatcggcgacgctctacagagcccgcttcaccggcttcgaa
gaccagtcctcggcagtctcggcctgcaaggcgctgaaggcacgctcttatgcatgtgtg
gtgatgaccagcgaggggtga

DBGET integrated database retrieval system