KEGG   Rhizobium sp. IRBG74: BN877_I1981Help
Entry
BN877_I1981       CDS       T02867                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN877_I1981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_I1981
Enzymes [BR:rir01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN877_I1981
Transporters [BR:rir02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN877_I1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: CDI08874
UniProt: U4PUV6
LinkDB All DBs
Position
1884310..1884936
Genome map
AA seq 208 aa AA seqDB search
MSELIFYTNPMSRGRIARWMLEEVGVPYRTEILRFETSMKSPAYRLINPMAKVPAIKHGD
TIVTEAAAICAYLADAFPGANLAPTPKSRGLYYRWMFFAAGPLEMAASMKAMGFEVPKEK
LRMAGCGSYADVMNTLERAVSENRFIAGDLFTAADVYVGAHVGWGLQFGTIEKRPAFIDY
LSHLTERPAFKRAAQLDEEAAKDMKATD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgatcttttacaccaaccccatgtcgcgcgggcgtatcgcgcggtggatg
ctcgaggaagtgggcgttccctatcgaaccgagatacttcgtttcgaaacctcgatgaaa
tcgcccgcctatcggctgatcaatccgatggccaaggtgcccgccatcaaacatggcgat
accatcgtcaccgaggccgccgcgatctgcgcctatctggctgacgcctttcccggtgcg
aacctagcgcccacacccaagtcacgcgggctctattaccgctggatgttctttgccgca
ggcccgctggaaatggcggcgagcatgaaggcaatgggttttgaagtgccgaaggaaaaa
ttgcgtatggccggctgcggcagctatgcggatgtgatgaacacgctggaacgggccgtc
agcgaaaaccgcttcatcgccggcgatctctttaccgccgccgatgtctatgtcggcgcc
catgttggctggggcctgcaattcggcacgattgaaaaacgcccggccttcatcgactac
ttgtcgcatctgaccgagcgcccggccttcaagcgggccgcgcagctcgatgaggaagcg
gcgaaggatatgaaagcgacggactag

DBGET integrated database retrieval system