KEGG   Rhizobium pusense IRBG74: BN877_I2162
Entry
BN877_I2162       CDS       T02867                                 

Gene name
ftsZ2
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I2162 (ftsZ2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rir04812]
    BN877_I2162 (ftsZ2)
   02048 Prokaryotic defense system [BR:rir02048]
    BN877_I2162 (ftsZ2)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I2162 (ftsZ2)
Cytoskeleton proteins [BR:rir04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   BN877_I2162 (ftsZ2)
Prokaryotic defense system [BR:rir02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BN877_I2162 (ftsZ2)
SSDB
Motif
Pfam: Tubulin FtsZ_C
Other DBs
NCBI-ProteinID: CDI09053
UniProt: A0A1L9CEZ2
LinkDB
Position
complement(2052553..2054307)
AA seq 584 aa
MTIQLQKPDITELKPRITVFGVGGGGGNAVNNMITAGLQGVDFVVANTDAQALTMTKADR
VIQLGVNVTEGLGAGSQPEVGRAAAEECIDEIIDHLNGTHMCFVTAGMGGGTGTGAAPVV
AQAARNKGILTVGVVTKPFHFEGGRRMRLAEQGIEELQKSVDTLIVIPNQNLFRIANDKT
TFADAFAMADQVLYSGVACITDLMVKEGLINLDFADVRSVMREMGRAMMGTGEASGPGRA
MQAAEAAIANPLLDETSMKGAQGLLISITGGRDLTLFEVDEAATRIREEVDPDANIILGA
TFDEALEGLIRVSVVATGIDRVAGVGEQNVAEMRAAAAAAKPLIRPSAAVAPAPAAVQPA
AVSQAPKAVDPIAQTIRSAEAEMERELGFAAHQQPAQDFRPQSKLFASSPAEAPAALRPA
QPVQQAAPAPVAPAPVYHAPEQHAAPAPRMQQPQAPVYQEPAPVARQPEPVRMPKVEDFP
PVVKAELDHRTHAAPAAQEERGPMGLLKRITNSLGRREEEEVPSDMMDAPSMAPQRRAPL
SPEASLYAPRRGQLDDHGRATPASSSHHDDDQLEIPAFLRRQSN
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgacgatacagctgcagaagcctgatatcacagagctgaagccacgcatcaccgtcttc
ggtgtcggtggcggtggtggtaacgctgtcaacaacatgatcacggccggcctccagggc
gtcgacttcgttgtcgccaacacggatgcccaggcgttgaccatgacgaaggcagatcgg
gtcattcagctcggcgtcaacgtcactgaaggtctcggcgccggttcccagccggaagtc
gggcgcgctgccgctgaagaatgcatcgacgagatcatcgatcaccttaacggcacgcat
atgtgcttcgtcaccgccggcatgggcggcggcaccggcaccggtgctgctcccgtcgtc
gcgcaggctgcgcgcaacaagggcatcctgacggttggcgtcgtcaccaagcctttccac
ttcgaaggcggccgccgcatgcgtcttgccgaacagggcatcgaggaactgcagaagtcc
gtcgatacgctgatcgtcattccgaaccagaacctcttccgtattgccaatgacaagacg
acctttgcggacgccttcgccatggccgaccaggttctctattccggcgttgcctgcatt
accgacctgatggtgaaggaaggtctcatcaacctcgacttcgccgacgtccgttcggtc
atgcgcgaaatgggccgcgcgatgatgggcaccggcgaggcttccggtccgggccgcgca
atgcaggctgcggaagcggcgatcgccaacccgctgctcgacgaaacctcgatgaagggt
gcgcagggcctcctgatctccatcactggcggtcgcgacctcaccctgttcgaagtcgac
gaagctgcgacccgtattcgcgaagaagttgatccggatgcgaacatcatcctcggcgca
accttcgatgaagcgcttgaaggcctcatccgcgtctccgtcgttgcaaccggcattgac
cgcgttgcaggcgtcggcgaacagaacgttgccgaaatgcgcgccgcagccgccgctgca
aagccgcttatccgtccttccgcggccgttgctcccgctccggccgcagtacagcctgcc
gcagtttcgcaggcaccgaaggccgtagacccgatcgcccagaccatccgttcggctgag
gccgaaatggaacgtgaactcggttttgccgcacatcagcagccggcccaggacttccgt
ccgcagagcaagctgttcgcatcctctccggctgaagcaccggcggcacttcgtccggcc
cagccggttcagcaggccgctccggctccggttgctcctgcaccggtctatcacgctccg
gaacagcatgctgctccggcaccgcgcatgcagcagccgcaggctcccgtctatcaggag
cctgcaccggttgcccgccagcctgagccggttcgcatgccgaaggtcgaagacttcccg
ccggtcgtgaaggccgagctggaccaccgcacccatgccgctcctgctgcccaggaagag
cgtggcccgatgggtcttctgaagcgcatcaccaactcgcttggtcgccgcgaagaagaa
gaagttccttccgacatgatggatgcgccgagcatggcgccgcagcgccgcgcaccgctt
tcgccggaagcaagcctctacgcaccgcgtcgcggccagctcgacgatcacggccgtgca
acgcctgcatcgtccagccaccacgatgatgaccagctggaaatcccggccttcctgcgc
cgccagtccaactga

DBGET integrated database retrieval system