KEGG   Rhizobium pusense IRBG74: BN877_I2163
Entry
BN877_I2163       CDS       T02867                                 

Gene name
ftsA
Definition
(GenBank) cell division protein with ATPase domain, involved in recruitment of FtsK to Z ring
  KO
K03590  cell division protein FtsA
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I2163 (ftsA)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rir04812]
    BN877_I2163 (ftsA)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I2163 (ftsA)
Cytoskeleton proteins [BR:rir04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   BN877_I2163 (ftsA)
SSDB
Motif
Pfam: FtsA SHS2_FTSA MreB_Mbl EutA PilM_2 B2
Other DBs
NCBI-ProteinID: CDI09054
UniProt: A0A1S9E7Y3
LinkDB
Position
complement(2054399..2055730)
AA seq 443 aa
MSFFGSSHFGLPRLKPLSSKRSHIVSVLDIGSTKVVCMIGRLTPRQESEILPGRTHKVEI
IGIGHQRSRGVKSGVIADLDALEGVIRLSVDAAERMAGLTVDSLIVNVSAGRLASDIYTA
SIDLGGQEVEASDLRKVLVAASQQSMRQDRAILHSLPTGYSLDGERGIRDPLSMYGDLLG
VDMHVVTVERTALKNLELCVNRAHLSVEGMVATPYASGLAALVDDEVELGCAAIDMGGGT
TTISVFAEGRLIHTDAIGLGGHHVTTDLARGLSTRIEDAERLKVVHGSALLNGADERDMI
SIPPIGEDDRDQPSQVSRALVTRIVRARIEETLELIRDRIQKSGFSPIVGKRVVLTGGAS
QLTGLPETARRILARNVRIGRPMGVAGLPVAAKGPAFSTACGLMIYPQVADIEIHAAQGG
MFSPFGNGSGRIARVGQWLKESF
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagctttttcggttcttcccatttcggtctgcctcgtctgaagccgctttcttccaag
cgcagtcacatcgtttcggtgctcgacatcggctcgaccaaggtcgtgtgcatgatcggc
cggctgacgccccgtcaggaaagcgaaatcctgcctggccgcacccacaaggtcgaaatc
atcggcatcggccaccagcgttcgcgcggcgtgaagtcaggcgtgattgccgacctcgac
gcgctggaaggcgtcatccgtctttcagtcgatgcggctgagcgcatggcgggcctgacc
gtcgacagcctgatcgtcaatgtttccgccggccgcctggcgagcgatatctacaccgcg
agcatcgatctcggcggccaggaagtggaagccagcgatctgcgcaaggttctggtggcg
gcaagccagcagtccatgcgtcaggaccgggcgatcctgcattcgctgccgacgggctat
tcgctggatggcgagcgcggtatccgcgatccgctgtcgatgtacggcgatcttcttggc
gttgacatgcatgtggtgactgtcgaacgcacggcgctgaagaaccttgaactttgcgtc
aaccgggcgcatctgtccgtcgagggcatggtcgcgacgccctatgccagcggtctagca
gcactggtggacgatgaagtcgaactcggctgcgccgccatcgacatgggcggcggcacg
acgacgatctcggtttttgccgagggccggctcatccatacggacgcgatcggccttggc
ggccatcacgtcacgacagatcttgcacgaggcctctcgacacgaatcgaagatgcggag
agactgaaggtggtgcatggttcggctttgctgaatggcgcggatgagcgcgacatgatt
tcgatcccgccgattggcgaagatgatcgcgatcaaccatcgcaagtttcaagagcattg
gttacccgcatcgtgcgggcacgtatcgaagagacgctggaattgatccgtgatcgtatc
cagaagtccggcttcagcccgattgtcggcaagcgcgtcgtcctgaccggcggtgcaagc
cagctgacgggtctgccggaaacggcgcggcgcattcttgcccgcaacgtccgtatcggc
cgccccatgggtgtggccggtcttccggtcgcggcaaagggcccggcattttcaaccgcc
tgcggattgatgatctatccgcaggtggcggacatcgaaattcatgcggcgcaaggcgga
atgttctcgccgtttggtaacggtagcggccggatagcccgggtggggcaatggctgaaa
gagagtttttga

DBGET integrated database retrieval system