KEGG   Rhizobium pusense IRBG74: BN877_I2164
Entry
BN877_I2164       CDS       T02867                                 

Gene name
ftsQ
Definition
(GenBank) Cell division protein FtsQ
  KO
K03589  cell division protein FtsQ
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I2164 (ftsQ)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I2164 (ftsQ)
SSDB
Motif
Pfam: POTRA_1 FtsQ
Other DBs
NCBI-ProteinID: CDI09055
UniProt: U4Q5P4
LinkDB
Position
complement(2055727..2056659)
AA seq 310 aa
MFAVIGKKSTAKKREQFAAAASADDRMVLPRPLRRVVRFGVSLATGRIHIPAHTGTIAAV
AFYAATGLYGMSLGGHTNIVTQATTSAAGFAVEDVKVSGNLQTSEIDVFQLLGLDGSTSL
IALDIDAARRKLVQLPWVEDVDIRKIYPKTVEVRLKEREAFGIWQHGSELSLIEKSGSVI
APLRDNKFASLPLFVGRDAETGAAGFVEQLADWPEIRSRVRAYVRIAGRRWDLHLDNGIV
VKLPEENLPQALQLLARLDLEEKVLSRDVAAVDLRLSDRTTIQLTEGAAERRQAAVDART
KALKKAEKNT
NT seq 933 nt   +upstreamnt  +downstreamnt
gtgtttgcggtgatcggcaaaaagtcgacggcaaaaaagcgcgagcaattcgcggcggcg
gccagtgccgacgatcgcatggtgttgccgcgtccgctgcgtcgcgtcgtgcgtttcggc
gtcagccttgcgaccggacgtatccacattcccgcccataccggtacgattgcggccgtc
gccttttatgcggcgaccgggctttatggcatgtcactcggcggccatacgaatatcgtc
acgcaggcaacgacctccgcggccggtttcgccgttgaggacgtgaaggtctccggcaac
ctgcagacctccgaaatcgatgtcttccagcttctcggtctcgatggcagcacgtccctg
atcgcgctcgacatcgacgccgcgcgccgcaagctggtgcagcttccctgggttgaggat
gtcgatatccgcaagatctatccgaagacggtcgaggttcgtctgaaggagcgtgaggct
tttggcatctggcagcacggctcggagctgtcgctgatcgaaaagagcggcagtgtcatt
gcgccgctgcgtgacaacaagtttgcctcgctgccgcttttcgtgggccgcgatgcggaa
accggtgctgccggtttcgtcgagcagctggctgactggccggaaatccgcagccgcgtc
cgagcctacgtgcgtatcgccggccgccgttgggacctgcatctcgacaacggcatcgtc
gtcaagctgccagaagaaaacctgccgcaggcgctgcagttgctggcgcggctcgatctg
gaagagaaagttctgtcgcgcgatgtcgctgccgtggacctgcgcctgtccgaccgtacg
acgatccaactgaccgaaggtgccgccgaacgccgccaggctgccgtcgatgcgcgcacc
aaggctctcaagaaagcggagaagaacacatga

DBGET integrated database retrieval system