KEGG   Rhizobium sp. IRBG74: BN877_I2165Help
Entry
BN877_I2165       CDS       T02867                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00473  D-Alanine metabolism
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
rir01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN877_I2165 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2165 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BN877_I2165 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2165 (ddl)
Enzymes [BR:rir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN877_I2165 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Amino acid ligase
   BN877_I2165 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: CDI09056
UniProt: U4Q934
LinkDB All DBs
Position
complement(2056647..2057573)
Genome map
AA seq 308 aa AA seqDB search
MSGKHVAVLMGGFSSERPVSLSSGNACAQALEDEGYKVTRVDVGRDVAAVLDALRPDVAF
NALHGPFGEDGTIQGILEYLAIPYTHSGVLASALAMDKAQAKKVAAAAGIPVAAERVMNR
FDFTSEHPLAPPYVVKPVREGSSFGVVIVKEDQSHPPQILTSSEWKYGDHVMVERYIHGR
ELTCGVLDGEALGVTEVVPLGHNFYDYDAKYAAGGSKHVIPAEISPKIYQKIQTLAVMAH
RAIGCRGVSRSDFRYDDRFSEDGEVIWLEVNTQPGMTPTSLVPEMAAHAGRSFGNLVSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaagcacgtagctgttcttatgggtggattttcgtcggagcggccggtcagc
ctgtcgtcgggcaacgcttgcgcgcaggctctggaagacgagggctacaaggtcacccgt
gtcgatgtcggccgcgatgtcgccgccgtgcttgatgcgctgcgcccggacgtcgctttc
aacgcgctgcatgggcccttcggcgaagacggcaccattcagggcatcctcgaatatctc
gccattccctatacccattccggcgtgctcgcctcggcgcttgccatggacaaggcgcag
gccaagaaggttgctgctgctgccggcattcctgtcgccgccgagcgagtcatgaaccgc
ttcgatttcaccagcgaacatccgctggcgccgccttatgtggtgaagccggtgcgcgaa
ggctcgagcttcggcgtcgtgattgtcaaggaagatcagtcgcacccgccgcagatcctc
acgtcctctgaatggaaatacggtgaccatgtcatggtcgagcgttatatacatggccgc
gaactgacctgcggggtgctcgacggcgaggcgctgggcgtcaccgaagtggtgccgctc
ggtcacaatttctatgattacgatgcgaaatacgctgctggtggctcgaaacatgtcatt
cccgcagaaatttcaccgaaaatttaccaaaaaattcaaacactggcggttatggcgcat
cgggcgatcgggtgccgtggcgtaagccgttcagactttcgttacgacgaccgtttctca
gaagatggcgaagttatctggcttgaagtgaatacacagccgggcatgacgccgacctcc
ctggtgcctgaaatggcggcccatgctggccgctcctttggtaaccttgtcagctggatg
gtggaggacgcttcgtgtttgcggtga

DBGET integrated database retrieval system