KEGG   Rhizobium pusense IRBG74: BN877_I2167
Entry
BN877_I2167       CDS       T02867                                 

Gene name
murB
Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase (MurB-like)
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00520  Amino sugar and nucleotide sugar metabolism
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN877_I2167 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2167 (murB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2167 (murB)
Enzymes [BR:rir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     BN877_I2167 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BN877_I2167 (murB)
SSDB
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-ProteinID: CDI09058
UniProt: U4PVH3
LinkDB
Position
complement(2059509..2060474)
AA seq 321 aa
MRQVDGVKLLGRLGDGVKELRGRLTPDAPMDRVTWFRAGGLAEVMFQPHDTDDLIAFLKI
LPEDVPLTVVGVGSNLLVRDGGIPGVVVRLSAKGFGQVELAGENRIKAGAICPDKHIAAM
AMDNGIGGFHFYYGIPGSIGGALRMNAGANGGETRERVVEVYAVDRQGNQHVLSNADMGY
SYRHSGADAGLIFTGALFEGYPEDKAKIRADMDAVRHHRETVQPIREQTGGSTFKNPEGH
SAWELIDEAGGRGLVIGGAQMSSLHCNFMINTGHATGYDLEYLGETIRKRVFDKSGIRLE
WEIKRLGLFMPGREVEPFLGA
NT seq 966 nt   +upstreamnt  +downstreamnt
atgagacaggtcgatggggttaaattgctggggaggctcggcgacggggtaaaggaattg
cggggacgtctgacaccggatgcgcctatggaccgcgtgacgtggttcagagccggcggt
cttgcggaggtgatgttccagccgcacgatacggatgatctgattgccttcctgaaaatt
ctgccggaagatgtgccgctgaccgtggttggcgtcggctcgaaccttctggtgcgtgac
ggcggtattccgggtgtggtcgtgcgcctgtccgccaagggcttcggccaggtggagctt
gccggtgaaaaccgcatcaaggcgggcgcgatctgcccggacaagcatattgcagccatg
gccatggataatggcattggcggcttccacttctattacggcattccgggctccatcggc
ggagcgctgcgcatgaatgcgggcgcaaacggcggcgagacgcgtgaacgtgtcgtggaa
gtctacgcggtcgaccgtcagggcaaccagcatgtgctttccaatgccgatatgggctac
agctatcgtcattccggcgccgacgcaggcctgatcttcaccggtgcgctcttcgagggc
tatcccgaggacaaggcgaaaatccgcgccgatatggatgcggtgcgtcatcaccgtgaa
accgtgcagccaatccgcgaacagaccggcggctcgaccttcaagaaccccgaaggtcat
tccgcatgggagcttatcgatgaggcgggcggtcgtggtctcgtgatcggcggcgcgcag
atgtcatcactgcattgtaatttcatgatcaataccggccatgcgaccggttacgatctg
gaatatctgggcgagaccatccgcaagcgcgtgtttgacaaatcgggcatccggcttgag
tgggaaatcaagcggctcgggctgttcatgcccggtcgtgaagtggagccttttctgggg
gcttga

DBGET integrated database retrieval system