KEGG   Rhizobium pusense IRBG74: BN877_I2168
Entry
BN877_I2168       CDS       T02867                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetyl-muramate:alanine ligase, L-alanine adding enzyme
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00471  D-Glutamine and D-glutamate metabolism
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BN877_I2168 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2168 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2168 (murC)
Enzymes [BR:rir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BN877_I2168 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Amino acid ligase
   BN877_I2168 (murC)
SSDB
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C TrkA_N
Other DBs
NCBI-ProteinID: CDI09059
UniProt: U4PVA0
LinkDB
Position
complement(2060471..2061886)
AA seq 471 aa
MKMPKAIGLVHFIGIGGIGMSGIAEVLHNLGHRVQGSDQADSANVQRLRDKGIEVFVGHT
ADNIGDAEVVVVSTAIKKNNPELVAAREKHLPIVRRAEMLAELMRFRNAIAIGGTHGKTT
TTSMVATLLEAGNLDPTVINGGIINAYGTNARMGEGEWMVVEADESDGTFLKLPADVAVI
TNIDPEHLDHYGNFDAVRAAFRQFVENVPFYGFGVMCLDHPEVQALVGRIEDRKVITYGE
NPQADVRFSNVRIDGTRSVFDVEIRRRRTGKIFSFKDLVLPMPGRHNVSNATAAIAVANR
LGISEADIKKGLASFGGVKRRFTLTGEANGVQVFDDYGHHPVEIKAVLKAAREACKGRII
AVHQPHRYSRLSSLFDDFAHCFNDADTILLAPVYAAGEDPIEGASSEALVSAIKAAGHRD
ARFLEKREDLASQVAAIANPGDFVVLLGAGNITQWAASLPSELKSISGKSE
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgaagatgccgaaagccataggccttgtgcatttcatcggcataggcgggatcggcatg
agcggcattgccgaagtgcttcacaatctcggccaccgggtacagggatcggaccaggcc
gacagcgccaatgtgcagcgtctgcgtgacaagggcatcgaggtttttgtgggccacacg
gctgacaatatcggcgatgcagaggtcgtcgtcgtttcgaccgcgatcaagaagaacaat
ccggagctcgtcgccgcgcgggaaaagcacctgccgatcgtgcgccgcgcggaaatgctg
gccgagctgatgcgcttccgtaacgccatcgccatcggcggcacgcacggcaaaacgacg
acgacctccatggtcgccacgctcctggaagccggcaatctcgacccgaccgtcattaat
ggcggcatcatcaatgcctatggcaccaatgcccgcatgggtgagggtgagtggatggtg
gtggaggccgacgagtccgacggcactttcctgaagctgccggccgacgtcgccgtcatc
accaatatcgatccggaacatctcgaccattacggcaatttcgacgccgtacgcgccgca
ttccgtcagttcgtcgagaacgtgcctttctacggtttcggcgtcatgtgcctcgatcat
cccgaagtgcaggcattggttggccgcatcgaagaccgcaaagttatcacatatggcgag
aacccgcaggccgacgtgcggttttcgaatgtccgcatcgacggtacgcgctcggtcttc
gacgtggaaatccgccgtcgccgcaccggcaagattttctctttcaaggacctcgtcctg
ccgatgcccggccgccataacgtttcgaatgcgacagcggcaatcgcggttgccaatcgt
ctcggtatttcggaagccgacatcaagaaggggcttgcctccttcggtggtgtcaaacgg
cgcttcacgctgacgggtgaagccaacggggtgcaggtttttgacgattacggtcaccac
ccggtcgagatcaaggctgtgctgaaggcggcgcgggaagcctgcaagggccgcatcatc
gccgtgcaccagccccaccgctacagccgtctttcgagcctgtttgatgatttcgcgcat
tgtttcaacgatgccgatacgattcttcttgctccggtttatgcagcgggcgaagatccc
atcgaaggcgcaagctccgaagcgctggtttcggccatcaaggccgctggccaccgtgac
gcgcgtttcctcgaaaagcgggaggaccttgcgtcacaggtcgcagccattgcgaatccg
ggtgatttcgtggttctcttgggggctgggaatatcacgcaatgggcagcgtcgctgcct
tcggaattgaagagcatatcaggaaagtctgaatga

DBGET integrated database retrieval system