KEGG   Rhizobium pusense IRBG74: BN877_I2169
Entry
BN877_I2169       CDS       T02867                                 

Gene name
murG
Definition
(GenBank) UDP-N-acetylglucosamine:N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
rir01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2169 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BN877_I2169 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2169 (murG)
Enzymes [BR:rir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     BN877_I2169 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Glycosyltransferase
   BN877_I2169 (murG)
SSDB
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_4_2 DUF917
Other DBs
NCBI-ProteinID: CDI09060
UniProt: U4Q5P6
LinkDB
Position
complement(2061883..2063019)
AA seq 378 aa
MSKGIVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSA
TIGSKNPISVAGSLWKLWVGLRAARRLVAKLKPVAVVGFGGYPTVPPLLASTGLGVPSII
HEQNAVMGRANKALAGRVKAIAGGFLPPAHGQYSEKTVATGNPVRPAVLAASKIPYTASQ
TGEPFQLVVFGGSQGAQFFSSAVPAAICLLKDEQRKRIVVTQQARPEDKDSVIASYQKLG
VKADVSPFFGDMASRIGEADLVISRSGASTVSELSVIGRPSILVPYPHALDHDQAANAAA
LSAAGGASVIKQAELSPQKLSGLLSSALAEPERLSATAAAAKATGKPHAADVLADLVEAI
ASGRSVQEFKKNIEGVGA
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagcaagggtattgttcttcttgccgccggtggaaccggcggccatgtgtttccggca
gaagcgctggcgcatacgctgaaggcacgcggttatcaggtgcatctcgtcaccgacagt
cgcgccgagcgttatgcgggcaagtttccggcagatgaaattcatgtggttccgtctgcc
accatcggctccaaaaacccaatttccgtggcgggttcgctctggaagctctgggttggc
ctgcgcgcggcgcgtcggctggtcgcaaaactgaagccggtcgcggttgtcggcttcggc
ggctatccgaccgtgccgccgctgctggcctccaccgggcttggagtgccgtcgatcatt
cacgaacagaacgccgtgatgggccgcgccaacaaggcacttgccgggcgggtaaaggca
attgccggcggcttcctgccgcccgcccacggtcaatattccgagaagaccgtcgcgacc
ggcaatccggtgcgcccagcggtgctggccgcctctaaaataccctacaccgcctcgcag
acaggcgagcctttccagctcgttgtctttggcggcagccagggcgcacagtttttctcg
agcgcggtacccgccgcaatctgcctcctgaaagacgagcagcgcaagcgcatcgtcgtc
acccagcaggcgcggccggaagacaaggacagcgtcatcgcgtcctaccagaagctcggc
gtgaaggcggatgtttcgcctttcttcggcgatatggcgtcgcgcatcggcgaggccgat
ctggtcatcagccgctcgggcgcttcgacggtatcggagctttcggtgatcggccgtccg
tcgatcctcgtgccttatccgcatgcgctggatcatgatcaggcggcgaacgcggctgcg
ctttcggcggcgggtggggcaagcgtcatcaagcaggcggagctctcgccgcagaagctc
tctggcctgctgtcctcggcgcttgccgaacccgagcggctttccgcaacggcggcggcg
gcgaaggcaaccggcaaaccgcacgcggcggatgtgctggccgatctggtggaggcgatt
gcctccggccggtctgtacaggaattcaagaagaatattgaaggagttggggcatga

DBGET integrated database retrieval system