KEGG   Rhizobium pusense IRBG74: BN877_I2170
Entry
BN877_I2170       CDS       T02867                                 

Gene name
ftsW
Definition
(GenBank) essential cell division protein (stabilizes FtsZ ring)
  KO
K03588  cell division protein FtsW
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I2170 (ftsW)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_I2170 (ftsW)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I2170 (ftsW)
Transporters [BR:rir02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BN877_I2170 (ftsW)
SSDB
Motif
Pfam: FTSW_RODA_SPOVE
Other DBs
NCBI-ProteinID: CDI09061
UniProt: A0A1L9CSH7
LinkDB
Position
complement(2063026..2064180)
AA seq 384 aa
MVSRVDRGPVAEWFWTIDRFFLAAFIALMGIGLMLSFAASPAVAERIGLNSFFFVERQAM
FMVPSLAIMVGLSFLSPRQVRRVAVIMLIASLLMMIFALFFGIEVKGARRWISIGTFSIQ
PSEFMKPAFVIVCAWLFAERARHPEIPGNLFAIITFGIVAALLIAQPDFGQTILTSVVWG
GMFFMAGVPWFWIIMLGGLGVGGIISAYLMLPHVAGRIDRFWTGEGDTFQVDTAREAIIR
GDWFGRGPGEGIVKRIIPDSHTDFIFSVAAEEFGIVFCMFLVAIFAFIVLRGLSHAFKEK
DDFCRFAVAGLVLQIGMQSMINIGVNLELMPAKGMTLPLISYGGSSMMAICVTAGFLLAL
TRHRPEKRAQERSFFRVGSGVPAE
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggtaagccgagttgatcgcggtccggtcgcggaatggttctggaccatcgaccgtttc
tttctggcggcattcatcgcgctgatgggcatcggcctgatgctgtcctttgcggcgtca
ccggccgttgccgagcgcatcggcctcaacagcttctttttcgttgagcgccaggcgatg
ttcatggtgccatcgctggcgatcatggtcggcttgtccttcctgtcgccgcgccaggtg
cgccgcgtggcggtcatcatgctgatcgcctcgctgctgatgatgatctttgcactgttc
ttcggcatcgaggtgaagggcgcgcggcggtggatttccatcggcactttctcgatccag
ccgtcggaattcatgaagccggctttcgtcatcgtctgcgcatggctttttgcagagcgg
gcgcgccatccggaaattccgggcaatctctttgcgatcatcaccttcggaatcgtggcc
gcacttctcatcgcccagcctgacttcggccagacgatcctgacctccgttgtctggggc
ggcatgttcttcatggcgggtgtgccgtggttctggatcatcatgctcgggggtctcggc
gttggcggcatcatctccgcctatctcatgctgccgcacgtggccggccgtatcgaccgt
ttctggacgggtgagggcgacacgttccaggtggacacggcgcgtgaagcgatcattcgc
ggcgactggttcggtcgcggaccgggtgagggcatcgtcaagcgcatcattcccgatagc
cataccgacttcatcttctcggttgcggcggaagaattcggcatcgttttctgcatgttc
ctcgtcgcaatcttcgccttcatcgtgctgcgcggcctgtcgcacgctttcaaggaaaag
gacgatttctgccgcttcgccgtggctggccttgtgctgcagatcggcatgcagtcgatg
atcaatatcggcgtcaatctggagctgatgcctgccaagggcatgaccttgccgctgatt
tcctatggtggttcgtcaatgatggcgatatgcgtgaccgccggtttccttctggcattg
acacgccacagacccgaaaagcgggcgcaggagcggagtttcttccgcgttggttccggc
gttcccgcggagtaa

DBGET integrated database retrieval system