KEGG   Rhizobium pusense IRBG74: BN877_I2171
Entry
BN877_I2171       CDS       T02867                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00471  D-Glutamine and D-glutamate metabolism
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BN877_I2171 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2171 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2171 (murD)
Enzymes [BR:rir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BN877_I2171 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Amino acid ligase
   BN877_I2171 (murD)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C TrkA_N IlvN UDPG_MGDP_dh_N YjeF_N NAD_binding_2
Other DBs
NCBI-ProteinID: CDI09062
UniProt: U4PYZ4
LinkDB
Position
complement(2064186..2065595)
AA seq 469 aa
MIPVTSFKGKKVALFGLGGSGLVTARALVAGGADVVAFDDNPDSVAKAEAEGIKTADLHT
IDWSSFSSFVLAPGVPLTHPKPHWSVDLAKASGVEIIGDIELFVRERRAHAPDCPFIAIT
GTNGKSTTTALIAHILKSAGRDTQLGGNIGTAVLSLDPPKAQRFYVVECSSYQIDLAPTI
NPTAGILLNLTPDHLDRHGTMQHYADVKERLVAGSGTAIVGVDDSYSTLIADRVERAGVR
VERISKRNVVSEGLYAEGSRILRAHGGTSSLLVDLDGIQTLRGSHNAQNAAAAIAACLAV
GVSEDEVCAGLKSFPGLKHRMQPVGRRGNVTFVNDSKATNADAAAPALSSFDRIYWIAGG
LPKAGGIASLSPLFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLDKAVQHAAADAEKD
ATPGNIVMLSPACASFDQYKNFEVRGDSFVAQVAALDGMTMLVHSGKGG
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgatcccggtcacgtcgttcaagggtaagaaagtcgctcttttcgggctcggcggttcg
ggtcttgtcacggcccgggcgctggtcgccggcggtgccgacgtcgtggctttcgatgat
aatcctgacagcgttgcaaaggccgaggccgagggcatcaagacggcggatctccacacg
attgactggtcgagtttctcctccttcgtgctggcaccgggcgtgccgctgacgcatccg
aagccgcactggtccgtcgatctggcgaaagcctccggcgtcgagatcatcggcgatatc
gagctctttgtccgagaacgtcgtgcccacgcgccggattgccccttcattgcgattacc
gggaccaacggcaagtcgaccaccacggcgctgatcgcacatattctgaaatcggctggt
cgcgatacgcagcttggcggcaatatcggtacggcggtactgagcctcgatccgcctaag
gcgcagcgcttctacgttgttgagtgctcgtcctaccagattgacttggcacccacgatc
aatccgactgccggcattcttctcaacctcactcccgatcatctcgaccggcatggcacg
atgcagcactatgccgacgtcaaggaacggcttgttgccggcagcggcacggcgattgtc
ggtgtcgacgacagctactcgacgctgattgccgatcgcgttgagcgtgccggcgtcagg
gttgagcgcatttccaagcgcaatgtcgtttccgaaggtctttatgccgagggcagccgc
atcctgcgggcgcatgggggaacttcgtcgttactggtcgatctcgatggtatccagacg
cttcgcggcagccacaatgcgcaaaatgcggcggcggcaattgcggcctgccttgcagtc
ggtgtttccgaggatgaagtttgtgcaggtctcaaatccttccccggcctcaagcatcgc
atgcagccggttggccgacgcggcaatgtcaccttcgtcaatgacagcaaggccaccaat
gccgatgcggcggcacctgcgctttcgagctttgaccgcatttactggattgccggcggt
ctgccgaaggccggcgggattgccagcctttcaccgcttttcccgcgcattgcaaaagcc
tatctgatcggcgaggcggcggcggaatttgcagcgacgctcggtgaagcggtgccctat
gaaatatccggcaccttggacaaggccgtgcagcatgcggcggcggatgcggaaaaagac
gcgacgcccggcaatatcgtgatgttgtccccggcttgcgcaagtttcgatcaatataag
aactttgaagtcagaggtgattcgtttgtcgcgcaggtcgcggcgctcgatggcatgacg
atgctcgttcactctggaaaagggggctga

DBGET integrated database retrieval system