KEGG   Rhizobium pusense IRBG74: BN877_I2172
Entry
BN877_I2172       CDS       T02867                                 

Gene name
mraY
Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
rir01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2172 (mraY)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BN877_I2172 (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2172 (mraY)
Enzymes [BR:rir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     BN877_I2172 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Glycosyltransferase
   BN877_I2172 (mraY)
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: CDI09063
UniProt: U4PVH9
LinkDB
Position
complement(2065599..2066699)
AA seq 366 aa
MLIWLVELSDKIQIFNLFRYITFRAGAAMFTSALIVFLFGPAIINSLRVRQGKGQPIRAD
GPQTHFKKAGTPTMGGLMILAGILGGSLLWGDLSNVYVVAVLMVTLGFGAIGFYDDYLKV
TKQSDKGFSGKARLGIEFLIAAIAVFFMMKMALASAPHGGTLGSSIAFPFFKEFVINLGY
FFVLFGAFVIVGAGNAVNLTDGLDGLAIVPVMIAAATFGVIAYLAGNAVFANYLQINFVP
GTGELAVIVGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGSIAVATKHEIVMVIVG
GLFVMETLSVIIQVFWFKRTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIISVGLALLGL
ATLKLR
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgctgatctggctcgtcgaactgtcggataaaattcaaatcttcaacctgttccggtac
atcaccttccgggcgggggcggcgatgttcacctctgcgttgatcgtcttcctgtttgga
ccggccatcatcaattcgctgcgcgtgcgtcagggcaaaggccagccgatccgcgccgat
gggccgcagacgcatttcaagaaagccggcactcctaccatgggcggcttgatgatcctc
gccggcattctcggcggttcgcttctgtggggcgacctgtcgaatgtctatgtcgtcgcc
gttctaatggtgacgcttggtttcggagccatcggcttctacgacgattatctgaaagtg
acgaaacagagcgacaagggtttttccggcaaggctcgtctcggcatcgaattcctgatc
gcggcgattgccgtgttcttcatgatgaagatggcgcttgcctcggcaccgcatggcggc
acgctcggcagctccatcgcttttcccttcttcaaggaatttgtgatcaatctcggttat
ttcttcgtgctgttcggtgctttcgtcatcgtcggcgcggggaatgcggtgaacctgacc
gacggtctcgacggtctcgccatcgtgccggtaatgatcgcggccgccactttcggtgtg
atcgcctatctcgccggtaacgccgtttttgccaattacctgcagatcaatttcgtgccc
ggcacgggtgaactcgccgttattgtcggcgccgttatcggtgccggcctcggttttctg
tggtttaatgcgccgcccgcggccatcttcatgggcgatacgggttcgctcgcgctgggt
ggcctgatcggctccatcgcagtcgccaccaagcacgagatcgtcatggtcatcgtcggc
ggtctcttcgtcatggaaaccctgtcggtcatcatccaggtcttctggttcaagcgcacc
ggcaggcgcgtcttcctgatggcgccgatccatcaccatttcgagaaaaagggctggacg
gaaagccaggtggtcatccgtttctggatcatttccgttggcctcgcgctgcttggcctc
gccaccctgaagctgaggtaa

DBGET integrated database retrieval system