KEGG   Rhizobium pusense IRBG74: BN877_I2173
Entry
BN877_I2173       CDS       T02867                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00300  Lysine biosynthesis
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
rir01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BN877_I2173
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2173
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BN877_I2173
Enzymes [BR:rir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     BN877_I2173
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C TilS_C
Other DBs
NCBI-ProteinID: CDI09064
UniProt: U4PVA5
LinkDB
Position
complement(2066723..2068129)
AA seq 468 aa
MIAITAGRPVGNLPTGITGISIDSRTVKPGEAFFAIKGDRVDGHDYTSFAVANGAGLLVV
AEAKLPALGRLTVPMIVVEDVLAALGKLAIAARQRTSARIIAVTGSVGKTTTKEMLRQAL
APSGRVHAAVASFNNHWGVPLTLARMPADTEFGVFEIGMNHSGEIRPLVKMVRPHVAIIT
TIAPAHLGNFNNIEEIAAAKAEIFEGVEQGGSVILNRDNAQFEQLEEAAQEQGIEHILTF
GQHAKADFRLADFESTTTGSTIWAILNGETSELHLNIPGRHIADNAMAVLGAVAITGANL
DRAFEALGSLEAVKGRGQRHHLQINGGSFLLIDESYNANPASMRASIAVLAETPTQGHGR
RVAVLGDMLEMGEFSAQLHEELAGPLLAAGIEHVWLAGEAMAALRDALPDSVTVIWFPTT
AELTDFALQWVQPGDALMVKSSLGLGFGKIVAALLDKYPAFPETERQV
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgatcgccatcaccgcaggacgcccggtgggcaacctgccgacaggaatcaccggcatt
tccatcgacagccggacggtgaagccgggcgaagctttcttcgccatcaagggtgatcgt
gtcgacggtcacgactatacgagtttcgcggttgccaacggggcaggacttctggtcgtt
gctgaagccaagctgccagcgctcggccgcctgacggtgccgatgatcgtggtcgaagat
gttcttgcagcccttggcaagcttgccatcgcggcgcgtcaaagaacatcggcgcgcatc
atcgcggtgacgggctcggtcggcaagacgacgacgaaggaaatgctgcggcaggcgctc
gcgccatcgggccgggtgcatgcggcggtggcttccttcaacaaccattggggtgttccg
ctgacgcttgcccgcatgcccgccgatactgaattcggcgtgttcgaaatcggcatgaac
cattccggcgaaatccggcctttggtgaagatggtccgcccgcatgtggcgatcatcacc
accatcgcgcctgcccatctcggcaacttcaacaacatcgaagagatcgccgccgccaag
gcggagattttcgagggcgtggagcagggcggttccgtcatcctcaatcgtgacaatgcc
cagttcgagcagcttgaagaggcggcgcaggagcagggcatcgaacacatcctgaccttc
ggtcagcatgccaaggcggatttccgccttgcggatttcgagagcacgacgacgggctcg
acgatctgggcgatcctgaacggcgaaaccagcgagctgcatctcaacattccgggccgg
cacattgcggacaatgcgatggcggtgctcggcgccgtggcgatcacgggcgctaatctc
gaccgtgctttcgaagcgctgggatcgcttgaggcggtgaaggggcgtggccagcgccac
catctgcagatcaacggcggctccttccttctgatcgatgaaagctacaacgccaatcct
gcctccatgcgggcgtcgatcgcggtgctggcggaaacgccgacgcagggccatggccgt
cgcgttgccgtcctcggcgacatgctggagatgggcgaattttcggcgcaactacatgag
gaattggccgggccattgcttgcggcgggtatcgaacatgtgtggctggcaggcgaggcg
atggccgctttgcgcgacgcgctgcctgatagcgtcaccgtcatctggttcccgacgacg
gcggaactcaccgatttcgccctgcaatgggtgcaaccgggagacgcgctgatggtaaaa
tcgtcacttggcctcggtttcggcaagattgtcgccgccctgcttgacaagtatccggca
ttccccgagacggaacgccaagtctga

DBGET integrated database retrieval system