KEGG   Rhizobium pusense IRBG74: BN877_I2174
Entry
BN877_I2174       CDS       T02867                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate 2,6-diaminopimelate ligase (UDP-N-acetylmuramyl-tripeptide synthetase)
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00300  Lysine biosynthesis
rir00550  Peptidoglycan biosynthesis
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BN877_I2174 (murE)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2174 (murE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2174 (murE)
Enzymes [BR:rir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BN877_I2174 (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Amino acid ligase
   BN877_I2174 (murE)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: CDI09065
UniProt: U4Q5Q0
LinkDB
Position
complement(2068153..2069622)
AA seq 489 aa
MNLRDISGNAFPELKELLLSEIGAIEIGGITADSRKAAPGSLFVAVSGTKADGATYVKDA
VAKGAVAVVSGQAVEAEVPVLVVTDPRLYLSLAASRFYGKQPETMVAVTGTAGKTSVASF
VRQIWAFAGHAAAQIGTTGVIAPGREDYGALTTPDPVTLHALLAELASEGVTHAAMEASS
HGLDQRRLDGVRLSAAGFTNLGRDHMDYHPTVEDYMAAKMRLFDTLMEKGAPAVIFADDP
WSDKAVHAAREAGLDVRTVGRNGQYLALKRVEHFRHKQMIEVHHDGVIHEVDIPLAGDFQ
VANALVAAGLAMSTGVAAATALKALEKLVGAAGRLELVGQTKNGALAYVDYAHKPDALEN
VLTSVRPFTSGRIITVFGCGGDRDKGKRPIMGEVATRLSDIVIVTDDNPRSEDAATIRSE
VMAAAPGALEIGDRSEAIRRAVSMLSHGDTLIVAGKGHEEGQIVGSVTLPFSDHEQVRTA
LAALEGSKI
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaatttgcgagatatatccggaaatgcgtttccggaattgaaagaattgctcctgtct
gagatcggggcgatcgaaatcggggggatcaccgcagacagccgcaaggctgcgccgggc
agcctgttcgttgcggtttctggcaccaaggctgatggtgcgacctatgtgaaggacgcg
gttgccaagggtgccgttgccgttgtttccgggcaagcggtggaagccgaagtgccggtt
ctggtcgtcaccgacccacgcctttatctctccctcgccgcttcccgcttttacggaaaa
caaccggaaaccatggtcgccgtcaccggcaccgcgggaaagacctcggttgcttccttc
gtgcggcagatatgggctttcgccggtcatgccgcagcccagatcggcacaaccggcgtc
atcgctcccggccgggaggattatggcgcgctgacgacgcccgatccggtgacgctgcat
gcgcttctggccgagcttgcgagcgagggcgtcacccacgcggcgatggaagcttccagc
cacggtcttgaccagcgccgcctcgatggcgtgcgcctttctgccgccggctttaccaat
cttggccgcgaccatatggattaccatccaaccgtcgaggattacatggccgcgaagatg
cggcttttcgatacgctgatggaaaaaggcgctcccgccgtgatcttcgccgacgaccct
tggtcggacaaggcggttcatgcggcgcgcgaagcgggtctcgatgtccgtaccgtcgga
cggaacgggcaatatctcgctttgaagcgcgttgagcatttccgccacaagcagatgatc
gaagtgcatcatgacggcgtcatccacgaagtcgatatcccgctggcgggtgatttccag
gtggccaatgcgctggttgccgccggtcttgccatgtcgacgggtgttgccgccgcaacg
gcgctcaaggcgctcgaaaagcttgtcggcgctgccggccgtctcgaattagtgggacag
acgaaaaacggcgcgcttgcctatgtggattacgcccataagcccgatgcgctggaaaac
gtgctgacctcggtccggcccttcacctccggccgcatcatcaccgtgttcggctgcggc
ggcgaccgcgacaagggcaaacgcccgatcatgggcgaggtcgcgacccgtctttccgac
atcgtcatcgtcactgatgataatccgcgctccgaagacgcggcgacaatccgctccgag
gtgatggcggcggcgcccggcgctctggaaattggcgacaggtccgaggcgatccgccgt
gcggtgtcgatgctgtcgcatggcgatacgctgatcgtcgcgggcaaagggcatgaagaa
gggcagatcgttggctccgtgacactgcctttttccgatcatgaacaggtgcgcactgca
ctggcagcgctggaaggatcgaaaatttga

DBGET integrated database retrieval system