KEGG   Rhizobium sp. IRBG74: BN877_I2367Help
Entry
BN877_I2367       CDS       T02867                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase/deoxyuridine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00240  Pyrimidine metabolism
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BN877_I2367 (tdk)
Enzymes [BR:rir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BN877_I2367 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: CDI09256
UniProt: U4Q9M5
LinkDB All DBs
Position
2254500..2255081
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTLIFTAAFDDRGGVGRVASRIGLSSDAL
TFDENTDLFAEVSALHVQAPVACVFVDEANFLSEHHVWQLAEIVDRLDIPVMTYGLRTDF
QGKLFPASKELLAIADELREIRTICHCGRKATMVARFDNEGNVVTEGAQIEVGGNEKYVS
FCRRHWVEAFNGG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaattattcgacgatgaatgccggcaaatcgaccatgctgctg
caggcgtcctataattatcaggagcgcggcatgcgcacgctgatcttcacggccgcgttt
gacgaccgcggcggcgtcggccgtgtcgcctcgcgcatcggtctgtcctccgacgccctg
accttcgatgaaaataccgatttgttcgctgaagtatcggccctgcatgtacaggcgccc
gtcgcctgcgttttcgtcgacgaggccaatttcctctcagaacaccatgtctggcagctt
gccgagattgtcgaccggctggacatcccggtcatgacctatggtctgcgcacggatttc
cagggcaagctcttccctgcctcgaaagaactgcttgcgattgccgacgagcttcgcgaa
atccgcaccatctgccattgcggccgcaaggcgacgatggtggcccgcttcgacaatgaa
ggaaatgtcgtcacggaaggcgcgcagattgaggtaggcggcaacgaaaaatatgtttcc
ttctgccgccgccactgggtggaggcgttcaacggcggctga

DBGET integrated database retrieval system