KEGG   Rhizobium pusense IRBG74: BN877_I2603
Entry
BN877_I2603       CDS       T02867                                 

Definition
(GenBank) conserved membrane protein of unknown function
  KO
K14205  phosphatidylglycerol lysyltransferase [EC:2.3.2.3]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01503  Cationic antimicrobial peptide (CAMP) resistance
rir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN877_I2603
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_I2603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_I2603
Enzymes [BR:rir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.3  lysyltransferase
     BN877_I2603
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, lysyl-phosphatidylglycerol (L-PG) synthase MprF [MD:M00726]
    BN877_I2603
SSDB
Motif
Pfam: LPG_synthase_C LPG_synthase_TM Acetyltransf_6
Other DBs
NCBI-ProteinID: CDI09490
UniProt: U4Q6V9
LinkDB
Position
2486364..2488964
AA seq 866 aa
MADKSEITETDIADSAVESFFARNRAYLTAAAITLIFVMMTFAIYRLTSEVRYDDVIAAL
LDTSFSSVLLAIVFTALSFLSLIFYDANAIEYVGKKVRFPSMAVTAFAAYAIGNTAGFGP
LSGGAIRFRAYSRLGLSPGDIARVIAFVTLSFGLGLLSVSALSTFIVAPRIAAIIGFDPL
VLRGAALAVIAILVATAYIGRNGRAIRLGKWRLRLPDSRTSSRQFLVSAFDIAASASVLY
VLLPETHLGWPTFFAIYATAVGLGVLSHVPAGLGVFETVMVAGLGNAISVDQLLGSLVLY
RVIYHVLPLVVAILVMIVSEMKQFAAKPVVSDISQLAVRLAPPLLSTFAIILGTMLIFSS
VTPTPGSNLDFLSNFVPLPIIEAAHFLTSILGLGLVVASRGLGQRLDGAWWIALVAASLA
LILSLLKAIAVFEAIFLGLFIVALAANMRSFNRHASLVKQALGPSWLAAMAVIVAGAATI
LLFVYRDTDYSHTLWWQFEFSEEAPRGLRALLGLVLASSTIAIFSLMRPVAFRPDAIKAE
DIASATDIVMKQDAADANLVRMGDKHVMFSESGNAFIMYGIQGRSWIAFADPVGDEDDFP
DLVWQFVEGARAAGARAAFYQISPFLLSHCADAGLRAFKLGELALVDLTAFELKGGKLAN
LRQSLSRGARDGLTFEVIEKTQVQDVLEELKQVSDGWLAHHNTREKRFSLGAFEPDYILS
QPVAVLRKDGKITAFANLMVTDTKKEATVDLMRFSPDAPRGSMDFLFVSIMQYLREAGYE
SFNLGMAPMSGMSKRDAAPVWDRIGSTLFEHGERFYNFKGLRAFKAKFHPKWEPRYLAVQ
NGADAALALMDATVLISGGVRGVIGK
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggcagacaagagcgaaattacagagaccgatattgccgactccgcggttgaaagcttt
tttgccaggaaccgtgcctacctgacggccgcggccataacgctcatcttcgtgatgatg
acgtttgcaatttatcgtctcacctcggaagtaagatacgacgatgtgattgcggccctt
ctcgacacgtccttttcctcggttcttcttgctatcgtctttaccgcgctgagcttcctg
tcactgattttttatgatgccaatgccatcgaatatgtaggcaagaaagtgcggtttccg
tcaatggcggtcacggccttcgcggcctacgccatcggcaacaccgccggcttcgggccg
ctgagcggcggcgccatccgcttccgcgcctattcccggctggggctttccccgggagac
atcgcacgggtcatcgccttcgtcacgctgtcgttcggccttgggcttttgtcggtgagc
gcgctttcaaccttcatcgtcgcgccccgcatcgccgcaatcatcggtttcgacccactc
gtgctgaggggcgcggcgctcgccgtcatcgccattctcgtggccacggcctatataggg
cgcaatggcagggcgatacgcctcggcaaatggcggctgcgccttccagacagccgtacg
tcttcgcgtcagttcctggtgtctgcattcgacatcgccgcttcggcttccgttctttac
gtgctcttgccggaaacgcatctcggctggccgaccttcttcgcgatctatgccacggcc
gtggggcttggcgttctcagccacgtgcccgccggcctcggggtcttcgaaaccgtgatg
gttgccggtctcggcaatgcgatcagcgttgatcagctgctcggaagcctcgttctctat
cgcgtcatttaccacgtgctgccgctggtggtcgccattctggtgatgatcgtttcagaa
atgaagcagtttgcggcaaagcccgttgtatccgatatcagccagcttgccgtgcggctg
gcgccaccgctgctctccacattcgcgatcattctcggcaccatgctgattttctcgagc
gtgacaccgacgccgggcagcaacctggatttcctctcgaacttcgtcccgttgcctatc
atcgaggccgctcactttctgaccagcattctcggccttggcctcgtcgtcgcctcccgt
ggcttggggcagagactggatggcgcatggtggatcgccctcgttgcggcatctctggcg
ctcattctctcgcttctcaaggccatcgcggttttcgaagcgatctttctcggcttgttc
atcgtcgcgctcgccgccaacatgcgcagcttcaaccgtcacgcctctctggtcaaacag
gcgctcgggccaagctggctcgcggccatggccgtcatcgtcgccggcgcggccaccatc
cttctcttcgtctatcgcgataccgattacagccatacgctctggtggcagttcgaattc
tccgaggaagcgccacgcggactgcgcgcccttttaggcctcgtgcttgcctcctccacc
atcgccatcttcagcctcatgagaccggtagccttccgcccggatgccatcaaggccgaa
gatatcgcaagtgctacagacattgtcatgaagcaggatgcggccgatgccaatctggtg
cgcatgggcgacaagcacgtgatgttttccgaaagcggcaatgccttcatcatgtacggc
attcagggccgctcatggatcgcgtttgccgatccggtcggcgatgaagatgatttccct
gacctcgtgtggcaattcgtcgaaggagcccgtgccgctggcgcacgtgccgccttctat
cagatttcgcccttcctgctgtcccattgcgccgatgcgggtctgcgcgccttcaagctg
ggcgaactggccctggtcgatctcaccgcattcgaactcaaaggtggcaagcttgccaat
cttcgccagtcgctgagccgcggcgcgcgcgacgggctgaccttcgaggtcatcgaaaag
acccaggtgcaggatgttctggaagagctgaaacaggtttccgacggctggctcgcccac
cataacacccgcgaaaaacgcttttcgctcggtgctttcgagccggactacattctgtcg
caacccgttgccgtgctgcgcaaggatggaaagattaccgccttcgccaatctgatggtg
acggatacgaaaaaggaagccaccgtcgatctcatgcgcttttcgccggatgcgccgcgc
ggctcgatggactttctcttcgtcagcatcatgcaatatctgcgcgaggccggttacgag
agcttcaatctcggcatggcgcccatgtccggcatgtctaaacgcgacgcggcgcccgtc
tgggaccggatcggcagcacactgttcgaacacggtgaacgattctacaacttcaagggg
cttcgcgccttcaaggccaagttccacccgaaatgggaaccgcgttaccttgccgtgcag
aacggtgcagatgccgctctggcgctgatggatgcgacggttctgatcagcggcggtgtc
agaggagtgatcggaaaatga

DBGET integrated database retrieval system