KEGG   Rhizobium pusense IRBG74: BN877_I2636
Entry
BN877_I2636       CDS       T02867                                 

Definition
(GenBank) RND multidrug efflux membrane permease
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I2636
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_I2636
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I2636
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_I2636
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_I2636
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I2636
Transporters [BR:rir02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   BN877_I2636
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    BN877_I2636
SSDB
Motif
Pfam: Biotin_lipoyl_2 HlyD_D23 HlyD_3 OEP HlyD HrpB7 Biotin_lipoyl CC2-LZ
Other DBs
NCBI-ProteinID: CDI09521
UniProt: A0A1L9CPX7
LinkDB
Position
2526729..2527931
AA seq 400 aa
MSRRILPLLASLCVTAILAGCSDGGESSQNAAQGAARPPSPVSVILMKTSEYPLTTVLPG
RASAFQTAEIRPRVTGIIREIPFKEGSEVKQGDVLYQIEDNTYLAEVAQAKANVAKAEAS
VPSAEANLARYERLVNSGATQIEYENAKVTLLQAQADVAQTKAALETAEINLDLTKVRAP
FDGITSATAFSIGNVVTANQTTALTTLRRIDPIYIDLMESSTNLLRLKKAISSGQLGGDT
KETGIHLTLEDGTEYKHDGKIDMSDMAVSETTGTFSIRALFDNPDDLLLPGTYVRATLTI
GKEKGFRIPQRAASRNANGELTAKFVTAENKVETRTFPSSQQSGNAWLVTENVKDGDKLI
VDGFQWIADGATVAPVEVTIDDRGIVVVPQQAQPAAAPSK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgagccgacgtattttacccctacttgcttctctgtgtgtgaccgcgattctggcgggc
tgcagcgatggcggcgaaagcagccagaacgccgcccagggcgcagcgcgtccgccgtct
ccggtcagcgtcattttgatgaagaccagcgaatatccgttgaccactgttctgcccggc
cgcgccagcgcgttccagacggctgaaatccggccgcgggtcaccggcatcatccgtgaa
attcccttcaaggaaggcagcgaggtgaagcagggcgacgttctctaccagatcgaagac
aatacctatctggcggaagtggcgcaggccaaggcaaacgtggcgaaggcggaagcgagt
gtcccgagcgccgaagccaaccttgcccggtacgaacggctggttaacagcggtgccacc
cagattgaatatgaaaacgccaaggtgacgctgctgcaggcgcaggccgatgtggcccag
accaaggcggcgctggaaacggcggagatcaatctcgatctcacgaaggtccgtgcaccc
ttcgacggcattaccagcgcaacggccttcagcatcggcaacgtggtgaccgcgaaccag
acgaccgctttgacgacgcttcgtcgcatcgatccgatttacatcgacctgatggaatcc
agcaccaatctcctgcgtctgaaaaaggcgatatcgtccggtcaacttggtggcgacacg
aaagagaccggcattcatctgacactggaagatggcaccgaatataagcatgacggcaag
atcgacatgtctgacatggcggtgagcgaaacgacaggcaccttctccatccgcgccctc
ttcgacaatccggacgatctcctgcttcccggcacctatgttcgcgccacgctgaccatc
ggcaaggaaaagggcttccgtatcccgcagcgcgcggcgagccgcaacgccaatggcgag
ctgacggcaaaattcgtgacggcggaaaacaaggtggaaacccgcaccttcccttccagc
cagcagtcgggcaacgcctggctggtgacggaaaacgtcaaggatggcgacaagctcatc
gtcgacggcttccagtggatcgcggacggcgcaaccgtggcgccggtggaagtgaccatt
gacgatcggggtatcgtcgttgtgccgcagcaggctcagcctgccgccgcgccttcgaaa
taa

DBGET integrated database retrieval system