KEGG   Rhizobium pusense IRBG74: BN877_I2637
Entry
BN877_I2637       CDS       T02867                                 

Definition
(GenBank) Putative component of multidrug efflux pump, acrB/acrD/acrF family
  KO
K18138  multidrug efflux pump
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_I2637
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_I2637
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_I2637
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_I2637
Transporters [BR:rir02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BN877_I2637
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    BN877_I2637
SSDB
Motif
Pfam: ACR_tran MMPL SecD_SecF
Other DBs
NCBI-ProteinID: CDI09522
UniProt: A0A1L9CQ66
LinkDB
Position
2527986..2531075
AA seq 1029 aa
MAHFFIRRPVFAWVIAIVIMLGGALAIWTLSISQYPDIAPTTVRVSATYNGASAETVEKS
VTTIIEDGMTGLDDLTYMTSSSSTGSSEVTLTFGNSILPDIAQVQVQNKLQLVQSQLPDT
VQQRGIQVSRSTSSILMVGALISTDGKRNSADLGDVFSSRVEDQIKRLEGVGSINVFGSE
YAMRIWLDPFKLNKYQLTTADVTGAIESQNTQVSVGSLGAVPAVKGQQLNVTVTAQSQLT
TVADFESVILKVEKDGATVRLSDVARIEIGQETYGGDSRSNGRPSAGFAVNLATGANALD
TAARVKAALTNVEGSLPEGVAIEYPYDTTPFVKLSIEKVVHTLIEAIILVFVVLLVFLQN
LRATFIPMIAVPVVLLGTFGVLALTGYSINTLTMFAMVLAIGLLVDDAIVVVENVERIMS
EEGLSPVEATEKSMGEITGAIIGIALVLTAVFIPMAFFGGSTGIIYRQFSITIVSAMLLS
AVVAIVLTPALCATMLKPIDHHKKQRGPGAWFNRGFGKTTDGYVSSIGYLLKRPLRVMII
FAIVIGGCVWFFSKLPSSFLPQEDQGVLLTIIQTPTGSNIERTNEVVKQVENYFREKEAA
NVESVFGVLGFSFSGSGQNNAIVFTKLKDFAERTAPDQHAGAIVQRAMGTFFGFRDAQVF
PLLPPAIQGMGTSSGFSMYLVDSGRNGTDALTASSKELIALATGNPKISSLRSDSQDNET
QMKIILDQEKMGAMGVDLSSVNLMLSTIFAGRDVNDFTLNGELKPVYVQGDAPYRMQPDD
LKFWYARNTSGEMVPFSSFSEVKWINAPPSLARFNGTGAISLEGTAGAGVASGDAMDEME
RLTASLPGGYTVAWQGISYQERLSGSQAPMLYALSVLIVFLCLAALYESWSIPFSVIMAV
PVGVLGALAAAHFFGQSNDVYFKVGLLTTIGLAAKNAILIVEFAKERQEHGLSLMEATLE
AAKLRLRPIIMTSLAFILGVVPLAIATGAGSAAQNAIGIGVLGGMLSATLLGIFFVPSFF
VIIRRLSRR
NT seq 3090 nt   +upstreamnt  +downstreamnt
atggcccatttcttcatcaggcgccccgtttttgcatgggttatcgccatcgtcatcatg
ctgggcggcgcccttgcgatctggactctttccatttcgcaatatcccgacattgcaccg
acaacggtccgcgtcagcgcgacctacaatggcgccagcgccgagaccgtagaaaaatcg
gtgacaaccatcatcgaggacggcatgaccggccttgatgacctcacctatatgacctcg
tcgtcctcgaccggcagttccgaagtgacgctgacattcggtaacagcatcctgcctgac
atcgcgcaggttcaggtgcagaacaagctgcagcttgtccagtcgcaattgcccgatacc
gtgcagcagcggggtatccaggtcagccgctcgacatcgagcatcctcatggttggtgca
ctgatctccaccgacggcaagcgcaattcggccgatctcggcgacgtcttctcctcgcgt
gtcgaagaccagatcaagcgcctggaaggcgtgggcagcatcaatgtcttcggctccgaa
tatgcgatgcgtatctggctggatcccttcaagctcaacaaataccagctgaccaccgca
gacgttaccggcgccatcgaaagccagaacacccaggtttcggtcggttcgctcggtgcc
gttcccgccgtcaagggtcagcagctcaacgtgacggtgacggcgcagagccagctcacc
actgtcgccgacttcgaatcggtcatcctgaaagtcgaaaaggatggcgcaaccgtccgc
ctcagcgatgttgcccgtattgaaatcggccaggaaacctatggcggcgattcccgctcc
aatggccgcccttcggccggtttcgcggtcaaccttgccacgggtgccaacgcgctcgac
acggcggcgcgtgtaaaagctgccctgaccaacgtcgaaggttcgctgcctgaaggcgtc
gcgatcgaatatccctatgacacgacgccgttcgtgaaactgtcgatcgaaaaggtggtg
catacgctgatcgaggcgatcatcctcgtcttcgtcgtgcttctggtgttcctgcagaac
ctcagagccacctttattccgatgatcgccgtgccggtcgtgcttctcggcaccttcggc
gttctcgcgctcaccgggtattcaatcaatacgctcaccatgttcgccatggttctggcc
atcggtctgctcgttgatgacgccatcgtcgttgtcgaaaacgtcgaacgaatcatgtcg
gaggagggtttgtcgccggtcgaggccaccgagaagtcgatgggtgagatcaccggagcc
atcatcggtatcgcgcttgtgctcaccgccgtgttcattccgatggccttcttcggcgga
tcgacgggcatcatctaccgccagttctcgatcaccatcgtttcggccatgctgctttcg
gccgtagtcgccatcgtgctgacgccggcgctctgcgccaccatgctgaagccgatcgac
catcacaagaagcagcgcgggccgggcgcgtggttcaaccgcggcttcggcaagacgacg
gacggctacgtgtcctccatcggttatctgctgaagcggcccctgcgcgtcatgatcatc
ttcgcaatcgtcatcggcggctgcgtctggttcttcagcaagctccccagctcgttcctg
ccgcaggaagaccagggcgtgctcctgaccatcatccagacgccgaccggttcgaatatc
gagcgaaccaatgaggtggtgaagcaggttgaaaactacttccgcgaaaaggaagccgcc
aatgtcgaatcggttttcggcgttctcggcttcagcttcagtggttcgggccagaacaac
gccatcgtcttcaccaaactcaaggatttcgccgagcgaacggctcccgaccagcacgcg
ggtgccatcgtccagcgcgccatgggcaccttcttcggtttccgcgatgcccaggtcttc
ccgcttctgccgccggccattcagggcatgggtacatcgagcggcttctcgatgtatctc
gtggatagcggccgcaacggcaccgacgccctgaccgcttcgtccaaggaattgattgcg
cttgccaccggcaatccgaagatcagctcgcttcgaagcgacagccaggacaacgaaacc
cagatgaagatcatcctcgatcaggagaagatgggggcaatgggtgtcgatctttcctct
gtcaatctgatgctgtcgacgatcttcgccggccgtgacgtcaatgacttcaccctcaac
ggtgaactcaagcccgtctatgtccagggcgacgcgccgtaccgcatgcagccggacgat
ctcaagttctggtatgcccgcaacaccagcggcgagatggtgccattctcctccttcagc
gaggtgaaatggatcaacgctcctccgtctctggcgcgctttaacggcacgggcgccatc
tcgctcgaaggcactgccggcgccggcgtagcctccggtgatgccatggacgagatggaa
cggctgaccgcgagcctgccgggcggttacacggtcgcgtggcagggcatctcctatcag
gaacgcctttccggctcacaggcaccgatgctctatgcgctctcggtgctgatcgtgttc
ctttgccttgccgccctttatgaaagctggtccatccccttctcggtcatcatggccgtg
ccggtgggtgtcctcggcgccttggccgcggcgcatttcttcggccagtcgaacgacgtc
tacttcaaggtgggcctgctgacgaccatcggcctcgcggcaaagaatgcgatcctgatc
gtcgaattcgccaaggagagacaggagcacgggctgagtctcatggaagcgacactggag
gccgcgaagctgcgcctgcggccgatcatcatgacatcgctggccttcatcctcggtgtt
gtgcctctcgcaatcgcaaccggtgcgggttcagccgcccaaaatgcaatcgggattgga
gtgttgggtggtatgctttctgcaacactgctcggaattttcttcgttccgtcctttttc
gtcatcattcgtcgcctttcaaggcgttaa

KEGG   Rhizobium pusense IRBG74: BN877_II0187
Entry
BN877_II0187      CDS       T02867                                 

Definition
(GenBank) Putative component of multidrug efflux pump, acrB/acrD/acrF family
  KO
K18138  multidrug efflux pump
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II0187
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_II0187
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_II0187
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_II0187
Transporters [BR:rir02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BN877_II0187
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    BN877_II0187
SSDB
Motif
Pfam: ACR_tran MMPL SecD_SecF
Other DBs
NCBI-ProteinID: CDI09988
UniProt: U4Q1T1
LinkDB
Position
linear:complement(173882..177016)
AA seq 1044 aa
MARFFIDRPIFAWVVAIFIMLAGLLAIPMLPIAQYPNVAPPQISVSTTYPGAAPEDIYQS
VTRPIEEELNGVPGLIYFESTSEASGRISINVTFEPGTNIGEAQVEVQNRIARVEPRLPQ
AVTQQGLRVEQAGTSFLMMVALTSVDGNTDAIGLGDYLSRNVLGELRRVPGVGSAQLFAT
QRSMRIWMDPDKMLGLSLTSSDVIGAIQAQNSQVAAGRIGASPNPIGQQISATVNVQGQL
TSPEEFGSIVLRANPDGSSVRLRDVARVEVGGESYNFSSRLNGKPSAAIGVQLSPTGNAL
QTSEGVRATMEELSRYFPQGIEYEIPYDTSPFVKISIEKVIHTLIEAIILVFVVMFVFLQ
NIRYTIIPTLVVPVALLGTCAIMYVSGFSINVLTMFAMVLAIGILVDDAIVVVENVERIM
AEEHLSPKEATRKAMGQISGAIIGITLVLTAVFVPMAFFPGAVGIIYQQFSLTMVVSILF
SGFLALSLTPALCASFLKPIKAGHHEKKGFFGWFNRNFDKASHKYSSSVGGIIKRSGRFM
VIYAALLAGLGWAYMQLPSSFLPNEDQGYLIVDIQAPAEASSDRTLQSIQQIEKIFLEEP
AVERVIAVSGFSFSGSGQNAGLAFATLKDWSERGPEDSAAAISARINGKLWGLPDAMSFA
LSPPPIQGLGNSSGFTFRLQDRSGAGQTALSAAGAQLMAAARQSPILAGLRIEGMPDAAQ
VNLVIDREKANTFGVTFSDINATISANMGSSYVNDFPNAGRMQRVTVQAEQGQRMKTEDL
LNLNVRNANGGMVPISSFASVEWVRGPSQVVGYNGYPAIRIGGQAAPGYSSGDAIAEMER
LARELPGGFGFEWTGQSLQEIQSGSQAPALIGLSVLFVFLLLAALYESWSIPLSVMLVVP
LGVIGSVAAVMLRGMPNDVYFLVGLVAIIGLSAKNAILIIEFAKDLRAEGKSTYDATVEA
AHLRFRPILMTSLAFSLGVLPMAIASGASAASQNAIGTGVLGGMISATILAIFFVPVFFV
FVMKIFGDRKKENEIAADAVSPAE
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggcacgttttttcatcgatcggcccatttttgcctgggtcgtcgccatcttcatcatg
ctggcgggcctgctcgccattcccatgctgcctattgcgcaatatccgaatgtggcgccg
ccgcagatttcggtctccacgacctatcccggcgctgcgccggaagatatctaccagagc
gtcacgcgcccgatagaagaggaactgaacggtgttcccggcctgatctatttcgagtcg
acatcggaggcttccggccgcatttcgatcaacgtcacgtttgaaccaggcaccaatatc
ggtgaggcgcaggtcgaagttcaaaaccgcatcgcacgcgtggagccacgcctgccgcag
gcagtgacgcagcagggcctgcgcgtggaacaggcaggcacctcgtttctgatgatggtg
gcgctcacctccgtcgacggcaataccgatgccatcggtctcggcgattatctcagccgc
aacgtgctcggcgaattgcgccgcgttcccggcgtcggcagcgcgcagctctttgccacc
cagcgctccatgcgcatctggatggatccggacaagatgctgggcctcagcctgacgtcg
agcgacgtcatcggcgccatccaggcgcagaactcgcaggtcgccgccggccgcatcggt
gcatcgccaaacccgattggccagcagatttccgcgaccgtcaacgtgcagggtcagctc
acatcgccggaagagttcggctccatcgtgctgcgcgccaacccggatggttcttccgtc
aggctgcgcgatgtcgcgcgagtggaagtgggcggcgaaagctataacttctcaagccgc
ctgaacggcaagccgagcgccgccatcggcgtgcagctgtcgccgaccggcaatgcgctg
cagacatcggagggcgtacgcgccacgatggaggagctgtcgcgctatttcccgcagggc
atagagtatgaaattccctatgataccagccccttcgtcaagatttcgatcgagaaggtc
attcacacgctgatcgaggccatcatcctcgtcttcgtggtgatgttcgtgtttctccag
aacatccgctacaccatcattccgacattggtggtgcccgtggcgctgctcggcacctgc
gcaatcatgtatgtctcgggtttctcgatcaacgttctgaccatgttcgccatggttctc
gccatcggcattctggtggatgacgcgatcgtcgtcgttgagaatgtcgagcgcatcatg
gcggaagagcatctgtcgccgaaggaggcgacccgcaaggcaatgggccagatttccggc
gcgatcatcggcatcacgctggtgctgacggccgtgttcgtgcccatggccttcttcccc
ggcgccgtcggcatcatctaccagcagttcagcctgaccatggtggtgtcgatcctgttc
tccggcttcctggccctgtcgctgacgccggcgctgtgcgcttctttcctgaagcccatc
aaggccgggcatcatgaaaagaagggcttcttcggctggttcaaccgcaacttcgacaag
gcgtcgcacaaatattcgtcttcggtcggcggcatcatcaagcgctccggccgcttcatg
gtgatctatgcggcgctgctggccggtctcggctgggcctatatgcaattgccgagctcg
ttcctgccgaacgaagaccagggctacctgatcgtggacatccaggcgcctgcggaagcc
agcagcgaccgcaccctgcagtccatccagcagatcgaaaagatcttcctggaagagccg
gcggttgaacgcgtcatcgccgtgtcgggcttctccttctccggttccggccagaatgcc
ggcctcgccttcgcgacgctgaaggactggagcgaacgtggaccggaggattctgcagcg
gccatctcagcccggatcaatggcaaactctggggcctgccggacgcaatgtccttcgcg
ctgtcgccgccgcccattcagggtctcggcaactccagcggctttaccttccgcctgcag
gacaggtccggagcgggccagacggcgctgagcgccgccggcgcgcagctgatggccgcg
gcgcggcagagccccatccttgccggccttcgcatcgaaggcatgccggatgcggcgcag
gtcaatctcgtcatcgaccgtgagaaggcaaacacattcggcgtgactttcagcgatatc
aacgccaccatctcggccaatatgggttcgtcctacgtcaacgacttccccaatgccggc
cgtatgcagcgcgtgacggtgcaggccgaacagggccagcgcatgaagaccgaggatctt
ctgaacctcaacgtccgcaacgccaatggcggcatggtgccgatcagctctttcgcctcg
gtggaatgggtgcgcggtccttctcaggtggtcggttataacggctatccggcgatccgt
atcggtggccaggcggcgccgggctactcctccggtgatgccattgccgaaatggaacgt
ctggcgcgcgaattgcccggcggtttcggtttcgaatggaccggccagtcactgcaggaa
atccagtcgggttcgcaggcaccggcgctcatcggtctcagcgtgctgttcgtcttcctg
ctgctcgcagcgctttacgaaagctggtcaattccgctctccgtcatgctggtggtgccg
ctcggggtcatcggctcggtggcggcggtgatgctgcgcggcatgccgaacgatgtctac
ttcctcgtcggcctcgtcgccatcatcggcctttccgcgaaaaatgcgatcctcatcatc
gaattcgccaaggatttgcgggcagagggcaaatccacctatgatgcgacggtggaggcg
gcgcatctgcgcttcaggccgatcctgatgacgtcgctcgccttctcgctcggcgtgctg
cccatggcgatcgcctccggcgcgagcgccgcgagccagaatgccatcggtaccggtgtt
ctcggcggcatgatctcggcgacgatcctcgcgatcttcttcgttcccgtgttctttgtt
ttcgtcatgaagattttcggggatcggaagaaggagaacgagattgctgctgacgccgtt
tcaccggcggaataa

KEGG   Rhizobium pusense IRBG74: BN877_p0445
Entry
BN877_p0445       CDS       T02867                                 

Gene name
ifeB
Definition
(GenBank) isoflavonoid transmembrane efflux pump protein
  KO
K18138  multidrug efflux pump
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_p0445 (ifeB)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_p0445 (ifeB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_p0445 (ifeB)
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_p0445 (ifeB)
Transporters [BR:rir02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BN877_p0445 (ifeB)
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    BN877_p0445 (ifeB)
SSDB
Motif
Pfam: ACR_tran MMPL SecD_SecF Patched
Other DBs
NCBI-ProteinID: CDI12167
UniProt: U4Q7X4
LinkDB
Position
IRBL74_p:complement(367503..370643)
AA seq 1046 aa
MARFFIDRPIFAWVIAIIIMGLGVLSIMRLPISQYPSIAGPSVVIGATYPGASAETVADT
VVQIIEKEMTGLDGLRYIDSSTTSTGRATVTLTFNLGTDPDIAQVQVQNKLSQAEASLPS
EVTRQGVTVEKSTTGFLMVIALISDDGTRSAIDLADYLNSYMVEPVSRLKGVGKVEVFGS
EYAMRIWLDPQKLKYYGLSPTTVINAISAQNAQISAGSFGAMPAPEGQQLNATVTAQSLL
KTPQDFERIVLRADTDGGLVLLRDVARAELGTENYEISSFYNGKPSSGMAIQLASGANAL
ETAELVKAKMADLGAFLPAGVSYVIPYDTTPFVSLSIEAVIHTLIEAIVLVVFVMLIFLH
NFRATLIPTLAVPVVLLGTFGIMAALGFSINTLTMLAMVLAIGLLVDDAIVVVENVERIM
RDEHLDPVAATKKSMGEIQGALVGIAMVVSAVFVPMAFFGGATGEMYKQFSVTIVAAMAL
SVLVALIFTPALCATMLKAHDHNAKPGLASRFSNWFERNFSWLTTRYGNIVRASAKRPVR
MFLVYLLLVGAMVFLYQKTPTSFLPDEDQGTLLTIIQTPPGSTAQNTEAVLGKVENYYMN
AEAQNVESVFSVRGFSFAGQGQNMGMMFVKLKDWEERKGKENSAQAIAARAFGPLMGGIK
EAIVVPLVPPAVTELGNSNGFTAFLQARSGQSHEQLLEARNMLLGLAAQSPKLMAVRPNG
VEDASQFELNIDWGKAGAVGLSAADVGSFLTTVWSSSYVNDFLYEGRMKRVYVQGEPLAR
TGPEDLALWRVPNANGDFVDLSTITSQNWVFGPQQVSRYDALPAMSIEGSAAPGFSSGEA
LAEMEALAAKLPPGFSLQWTGMSLEEKDAGAGALPLYGLALATMFLCLAALYESWTIPVA
VLLAMPVGILGALLGAWIGGQSNGVYFQVGLLTVVGLTGKNGIMIVEFARERMAQLGESA
FEAVCEAAKLRFRPILMTSLAFGLGVIPLVISTGAGAGARQAIGFATFFGTVTGTLLAIV
FVPVFFVLISGIFSRRSVKAAEPKTA
NT seq 3141 nt   +upstreamnt  +downstreamnt
atggcgcggtttttcatagacaggcccattttcgcctgggtcatcgcgatcatcatcatg
ggcctcggcgtcctgtcgatcatgagactgccgatctcgcaatatccctcgatcgccggt
ccatccgtggtcatcggcgcgacctatcccggcgcatccgccgaaacggtcgcggatacg
gtggtgcagatcatcgagaaggaaatgacgggccttgacgggctgcgttacatcgactca
tcgacgacctctaccggtcgcgccaccgtgacactcacattcaatctcggcacggatccc
gacatcgcccaggttcaggtccagaacaagctcagccaggccgaagcgagcctgccttcg
gaagtgacgcgtcagggtgtgacggttgagaaatcgacaaccggcttcctgatggtgatc
gcgctgatctcggacgacggaacccgaagcgccatcgatctcgccgattatctgaactcc
tatatggtcgaaccggtgtcgagactgaagggtgtcggcaaggtcgaagtgttcgggtcg
gaatatgcaatgcggatctggctcgatccacagaagctgaaatattacggcctctctccc
acgaccgtcatcaatgccatcagcgcccagaatgcgcagatatcggccggttccttcggc
gcgatgccggcgccggaaggccagcagctcaatgccaccgtcacagcccagtcgctcctg
aagacgccgcaggatttcgaacgcattgtattgcgtgccgataccgatggcgggctggtg
ctgctgcgcgatgtcgcgcgggccgagcttggaacggaaaactacgaaatctccagtttc
tataacggcaaaccgtcgtcaggtatggcgatccagctggcatccggcgccaatgcactt
gaaacggcggagttggtgaaggccaagatggccgatctcggtgcgtttcttcccgccggc
gtgagctatgtcattccctatgatacgacgccgttcgtctcgctttccatcgaggcggtc
attcacacgctcatcgaagcgatcgtactggtcgtgttcgtgatgctgatcttcctgcat
aatttccgcgcgacgctgatcccgacgctggccgtgccggtggttctgcttggaaccttc
ggcatcatggcggcgctcggattttcgatcaatacgctcaccatgctcgcgatggttctg
gcgatcggtctgctggtagatgatgcgatcgtggtggtggaaaatgttgagcgtatcatg
cgcgacgagcatctcgatcccgtcgcggccacgaaaaaatcgatgggagaaatccagggg
gcgctcgtcggcatcgccatggtggtttccgccgtcttcgtgcccatggcgttttttggc
ggcgcaacaggggaaatgtacaagcagttctcggtgaccatcgtcgcggccatggcgctc
tcggtgctggtcgccctcatcttcacgccggcgctttgcgcgacgatgctgaaggcccat
gatcacaatgccaagccgggtcttgccagccgtttcagcaactggttcgagcgcaatttc
tcatggctgacgacacgatacggcaatatcgtcagggcttcggcgaaaaggcctgtcagg
atgttccttgtctacctgcttctggtgggtgccatggtcttcctttaccagaagacgcca
acctcgttccttcccgatgaagatcagggaaccctgctcaccattatccagacaccaccc
ggttccaccgcgcaaaataccgaggcggttctgggcaaggtggaaaactactacatgaat
gccgaagcccagaacgtcgagtctgtcttctcggttcgtggtttctcctttgccggtcaa
ggccagaacatgggcatgatgttcgtcaagctgaaggactgggaagagcgcaagggcaag
gaaaactccgcccaggccatcgccgcgcgtgccttcgggcctctgatgggcggcatcaag
gaggcgatcgtggttccgctggtaccgccggcggtcacggaactcggcaattccaatggc
tttaccgccttccttcaggcgcgttccggccagagccacgagcagcttctggaagcgcgc
aacatgctgctgggtcttgcggcccaaagcccgaagcttatggccgtccggccgaacggc
gtcgaggatgcttctcagttcgaactcaacatcgactggggcaaggccggcgctgttggc
ctcagcgctgcggatgtcgggtcgttcctgaccaccgtctggtcgagttcctatgtgaac
gacttcctttacgagggacgcatgaaacgcgtttacgtgcagggcgagcccttggcacgc
acagggccggaagatcttgctctctggcgggtgccgaatgcgaatggcgatttcgtcgat
ctttcaaccatcaccagccagaactgggtcttcggccctcagcaggtcagccgttatgac
gccctgcccgccatgtcgatcgaagggtcggcggctccgggtttctcctccggtgaggcg
ctggcggagatggaggcgcttgccgcgaaactgccgccgggcttcagcctgcaatggacg
ggaatgtcgctcgaagaaaaggatgccggtgccggcgccctacctctctacgggttggcg
ttggcaaccatgttcctttgccttgcggctctttatgaaagctggaccattcccgttgcg
gttctgctcgccatgccggtcggtattctcggtgcgcttctgggcgcatggatcggcggg
cagtcgaacggcgtctacttccaggtgggtcttctgaccgtggtcggcctgacgggcaag
aacggcatcatgattgtcgaatttgcgcgagagcgaatggcgcaacttggcgaaagcgca
ttcgaggcggtttgcgaggcggcgaagcttcgcttccggccgatcctgatgacgtcgctt
gcctttggcctcggtgtcattccgctggtcatatcgacgggcgccggcgccggcgcgcgc
caggctatcggctttgccaccttctttggaacggtgacggggactttgctggcgattgtt
ttcgtgccggtcttcttcgtgctgatatcgggaatatttagccgcagaagcgtgaaggcg
gcggagccgaaaaccgcctga

DBGET integrated database retrieval system