KEGG   Rhizobium pusense IRBG74: BN877_I2681
Entry
BN877_I2681       CDS       T02867                                 

Definition
(GenBank) N-acetyl-beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00511  Other glycan degradation
rir00520  Amino sugar and nucleotide sugar metabolism
rir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN877_I2681
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BN877_I2681
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rir03110]
    BN877_I2681
Enzymes [BR:rir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BN877_I2681
Chaperones and folding catalysts [BR:rir03110]
 Intramolecular chaperones
  Others
   BN877_I2681
SSDB
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Other DBs
NCBI-ProteinID: CDI09566
UniProt: U4QAJ7
LinkDB
Position
complement(2580016..2581935)
AA seq 639 aa
MALANYRLENSWHPLAESASGGFTFTLINLSREPLRDFRIVYTSLTRTVDKPVCGNAVYL
RRNANFHEFAPPAGFVLEPGKSWRFTVDGLLRPARHRTDGAKSAYISLADGTHRAVDVGD
LMLDGRHSEPAPVLLPEGKLVLPFAIQPWPAEIDAEPGDGFPVALFPSEDAKADEVLAVE
TVLSLFRRLFAVGHVPFSLAPVHEGKALHFKQHSGLEAEGYRLSFSSDFVVVEYSAAAGL
QYGLTVLAQLLHGARLDPRFRFPASGTISDAPRYSWRGCHLDVSRQFYPTQDVVRLIDIL
AWLRMNRFHWHLTDDEAWRLEIKAYPLLTTVGATRGPDAPLLPQLGNGAEPVSGYYTQDD
VRMVVAHAAALNVEIVPEVDIPGHSTAALVAYPELTDGQEAPDSYRSVQGYPNNALNPAI
ELTYEFLGKVFDEMVELFPSRLIHIGGDEVADGSWLASPLAKALMEKEGLDGTFGIQSHF
MKRIQAMLLERGRQLAGWDEVSHGGGVEPAGTLLMAWQKPEVGLELARQGYDVVMTPGQA
YYLDMVQDEAWQEPGASWAGTVPPSHTYSYEAIGDFPEELKERMKGVQACIWSEHFLNRA
YFNHLVFPRLPAIAEAAWTPKAQKDWLRFAAIVPFSPVY
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggcgctcgcaaactatcgtctcgaaaattcatggcatccactggcggaatccgcatcc
ggaggctttaccttcacgctgatcaatctttcccgagagccgctgagggatttccgtatc
gtttacacgtcgctgacgcggacggtagacaagccggtttgcggcaatgcggtttatctg
cgccgtaacgccaatttccatgaattcgcgccgcctgccggtttcgtgctggaacccggc
aaatcctggcgtttcaccgtcgatgggttgctgaggcccgcccggcatcgcacggatggt
gcaaaatccgcctatatcagccttgccgacggcacgcatcgcgccgttgatgtcggggac
ctgatgttggacgggcgtcacagcgagccggcaccggtgctgcttccagaaggcaagctt
gttctgccttttgccatccagccttggcccgccgaaatcgatgccgagcccggcgacggc
tttcccgtcgcgctcttcccgtcggaagatgccaaggccgatgaagtccttgcggtggaa
accgtgctttcgctgttccgcaggctatttgccgtcgggcacgtgcccttcagcctcgcc
cctgtgcatgagggaaaggccctgcacttcaaacagcatagcggactggaggcggaaggt
tatcgcctttccttttcctctgactttgttgtcgtggaatactcggccgctgccgggctg
cagtatggcctgacggttctggcgcaattgctgcatggcgcgcgtctcgatccgaggttc
cgttttcccgcgtccggcacaatcagcgatgcgccgcgttatagctggcgcggctgccac
ctggatgtatcgcggcaattttatccgacgcaggatgtcgtgcggctcatcgatattctt
gcatggctgcgcatgaaccgcttccactggcatctgacggatgatgaggcgtggcgtctt
gaaatcaaggcttatccgttattgaccacggtcggcgccacacgcggcccggatgcgccg
cttctgccgcagctcggcaacggcgcggaaccggtctccggttattatacccaggacgat
gtgcgcatggtcgttgcccatgcggcggcgctgaatgtcgaaatcgtgccggaagtcgat
attcccggccatagtacggctgccctcgtcgcctatccggaactgacggacgggcaggaa
gcccctgacagctatcgctccgtgcagggatatcctaacaacgcgctcaatccggccatc
gaactcacttacgaattcctcggcaaggttttcgatgagatggtggagctgttcccgtct
cggctcatccacatcggcggcgatgaggttgcggacggatcctggctcgcctcgccactc
gccaaggcgctgatggaaaaggagggactggatggtactttcggtatccagtcccatttc
atgaaacgcattcaggccatgttgctcgagcgcggccgtcagctggccggctgggatgag
gtttcgcacggcggcggcgtcgagcccgcgggaacattgctgatggcgtggcagaagccg
gaggtcggccttgaactcgcaaggcagggttacgatgtggtgatgaccccggggcaggcc
tattatctcgacatggttcaggacgaagcctggcaggagccgggtgccagctgggccggc
accgttccgccttcccacacctactcttatgaggcgatcggtgattttccagaggagttg
aaggagaggatgaagggcgttcaggcctgcatctggtccgaacatttcctcaaccgcgcc
tatttcaaccatctggtcttcccgcggctaccggccattgccgaggcggcctggacaccg
aaggcgcagaaggactggttgcgttttgcggccatcgttccctttagtccggtgtattga

DBGET integrated database retrieval system