KEGG   Rhizobium pusense IRBG74: BN877_I2805
Entry
BN877_I2805       CDS       T02867                                 

Gene name
mtgA
Definition
(GenBank) Monofunctional biosynthetic peptidoglycan transglycosylase (Monofunctional TGase)
  KO
K03814  monofunctional glycosyltransferase [EC:2.4.1.129]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN877_I2805 (mtgA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rir01003]
    BN877_I2805 (mtgA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_I2805 (mtgA)
Enzymes [BR:rir01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BN877_I2805 (mtgA)
Glycosyltransferases [BR:rir01003]
 Polysaccharide
  Bacterial polysaccharide
   BN877_I2805 (mtgA)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   BN877_I2805 (mtgA)
SSDB
Motif
Pfam: Transgly
Other DBs
NCBI-ProteinID: CDI09689
UniProt: U4PX57
LinkDB
Position
complement(2708987..2709733)
AA seq 248 aa
MSSTPESDADYAVLAEDRSSPKVDFRTLAKRIIMTLLALLILPYLLIPVYALPFIRPVST
LMLADLVTLQGYDRRWVPLEDISPRLVQSVMMSEDGQFCFHGGVDWNQMQSVVSNALDGA
ATRGASTIPMQTAKNLFLWNGRSFLRKGLELPLAIAADFVWSKKRMMEIYLNVAEWGPGI
YGIEAAAQHHFKVPAAKLSSRQAALLAVSLPNPIDRVASKPGRGLQRLAGLIERRARASG
SYVGCVLD
NT seq 747 nt   +upstreamnt  +downstreamnt
gtgagcagtacgcctgaaagcgacgcagattacgccgtgctggcggaagaccggagcagt
ccgaaggtggattttcgcacgttggccaagcgcatcatcatgaccttgctggcattgctc
atcctgccttatctgctgattccggtttatgcgttgcccttcatccggcccgtgtcgacg
ctgatgcttgccgatctggtcacgctgcaaggctatgacaggcgctgggtgccactagag
gatatttcgccgcgcctcgtgcaatcggtgatgatgtccgaggatgggcaattctgtttt
cacggcggggttgactggaaccagatgcagtccgtggtcagcaatgcgctcgacggggcc
gcgacgcgcggcgccagcaccatcccgatgcagacggccaaaaacctgtttttatggaac
ggtcgttcgtttctgcgcaagggactggaattgccgctggcgattgccgccgatttcgtc
tggtcaaaaaagcggatgatggagatttatctcaacgtcgccgaatggggaccgggtatt
tacggcatcgaggctgccgcccagcaccatttcaaggtgccggccgcgaagctcagttcc
cgacaggccgcacttctggccgtttcgcttcccaatcccattgatcgtgtggccagcaag
ccggggcgcgggttgcagaggctcgccggccttatcgagcgccgcgcccgcgcctcgggc
agctatgtcggctgcgtgctggattga

DBGET integrated database retrieval system