KEGG   Rhizobium pusense IRBG74: BN877_I2843
Entry
BN877_I2843       CDS       T02867                                 

Gene name
ftsK
Definition
(GenBank) DNA translocase
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_I2843 (ftsK)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_I2843 (ftsK)
SSDB
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_gamma FtsK_4TM AAA_10 DUF87 DEAD TrwB_AAD_bind T2SSE AAA_22 ResIII AAA_19
Other DBs
NCBI-ProteinID: CDI09726
UniProt: U4QB03
LinkDB
Position
2762296..2764959
AA seq 887 aa
MHSPTFDGRHTRFVLTAFFVRQIMALAGFALLATIALGIAALATWNVADPSLSYATGNQP
TNLLGYGGAIFADIVMQFLGLSAIISLLPVIAWAIALIAGRKLQRIPARLVAWIAGAIVC
AASLGCFPAPVTWPLPNGIGGVIGDMILRFPALFIGAYPTGTVATILGVIFAAPAAWLML
FAAGIVGGLDDELEREEPAPAVSKARAVREAEEDDEDDGEGFFANILAFGALTHYWYITQ
ARFRRLFGLKSKSLHDEFEHPYDFNEYEFGTLNEPSRLKTAINRLDQRAEPSFEERTASR
RQMSPPSIAPGHEDDGDGEPSFGTDEARLPSGILSDDDVDQKFTARQAPGRGQTKITAPS
ARPKPSERVAREAQASFIAADGFQLPTVHLLAEPKNIVRDNTLSEEVLEQNARLLEGVLE
DFGVKGEIIHVRPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAIAARVAVVPGRNAI
GIELPNQTRETVFLRELIGSRDFENSKAKLAMALGKTIGGEPVIADLAKMPHLLVAGTTG
SGKSVAINTMILSLLYRMSPEQCRLIMIDPKMLELSIYDGIPHLLSPVVTDPKKAVVALK
WTVREMEERYKKMSKIGVRNIDGFNSRVQQALDKGEILTRTVQTGFDRQTGEAIYETEEF
DLKPLPYIVVIIDEMADLMMVAGKDIEGAVQRLAQMARAAGIHVIMATQRPSVDVITGTI
KANFPTRISFQVTSKIDSRTILGEQGAEQLLGMGDMLYMAGGGRIQRVHGPFVSDNEVEE
IVSYLKTQGSPEYLEAITEEEDEDGAGASPAGGASFSDSEDPYDQAVAVVLRDGKASTSY
VQRRLGIGYNRAASLIERMEQEGIIGPANHAGKREILVPTEADIIER
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgcattctccgacattcgatggtcgtcacacacgttttgtgctgacggcgtttttcgtg
cggcagattatggctctggccggtttcgctctgcttgccacgattgcactcggtatcgcc
gcgctcgcgacgtggaatgtggcagatccgagcctgtcctatgccacaggaaaccaacca
accaatctcttgggctacggcggcgcgatcttcgcggatatcgttatgcagttcctcggg
ctttcggccatcatttccctgctgccggtcattgcatgggcgatcgccctgatcgccggc
cgcaagctgcagcgcatacccgcccgcctcgtggcctggatcgcaggcgcgatcgtctgc
gctgcgtccctcggctgctttccggctcccgtcacctggccgctgccgaacggtatcggc
ggcgtgatcggcgacatgatccttcgttttcccgccctattcatcggcgcttatcccacg
ggcaccgttgcgacgatacttggggtaatattcgccgcgccggctgcctggctcatgctg
tttgccgccggcattgtcggcggtctggacgatgaactggagcgtgaagaacccgcaccg
gccgtcagcaaggcccgcgccgtccgcgaggcggaagaggacgacgaggatgatggcgag
ggtttcttcgccaatattctcgccttcggcgcactgacgcactactggtacatcacccag
gcccgttttcgtcgcctcttcggcctgaagtcgaaatcgctgcatgacgaattcgaacat
ccctatgatttcaacgagtatgaattcggcacgctaaacgagccgtcgcgcctcaagact
gcgatcaaccgtctcgaccagcgcgcggaaccctctttcgaagaacgaactgcatcgcgt
cgccagatgtctcctccctccatcgcgcccggtcatgaagacgatggggacggcgagccg
tccttcggtactgacgaggcccgcctgccaagtggcatcctttccgatgacgacgtcgac
cagaaattcactgcccgacaggcgccgggacgcggacagacgaaaataaccgctccttcg
gcacgcccgaagcccagtgagcgtgtggcacgcgaagcacaggcctctttcatcgccgca
gacggtttccagcttcctaccgttcaccttctggcggagcccaagaacattgttcgcgac
aatacgctaagcgaagaggtgctcgagcagaacgcccgtcttctcgagggggttcttgaa
gacttcggcgtcaagggtgaaatcattcatgtccgccccggcccggtcgtcaccctttac
gaactggaaccggcacccggcatcaaatcgtcgcgtgtcatcggcctcgcggatgatatc
gcccgctccatgagcgcgatcgccgcccgcgtggccgttgttcccggccgcaatgcgatc
ggcatcgaactgccgaaccagacccgcgaaaccgtgttcctgcgcgaactgatcggcagc
cgcgatttcgaaaacagcaaggccaagcttgccatggcgctcggcaagaccatcggcggc
gaacccgtcatcgccgatctcgccaagatgccgcacctgctcgttgcaggcaccaccggt
tcgggcaagtccgttgccatcaacaccatgatcctgtcgctgctttaccgcatgtcgccg
gaacagtgccgcctgatcatgatcgacccgaaaatgctggaactgtcgatctatgacggc
attccgcacctgctttctcccgtcgtaacggatccgaaaaaggcggtcgtcgcgctcaaa
tggacggtgcgcgagatggaggaacgctacaagaagatgtccaagatcggcgtgcgcaat
atcgacggcttcaacagccgcgtgcagcaggcgctcgacaagggcgaaatcctcacccgc
acggtgcagaccggtttcgaccgccagaccggcgaggcaatctacgaaacggaagagttc
gatctgaagcccctgccctatatcgtcgtcatcatcgacgagatggccgacctgatgatg
gtggccggcaaggatatcgaaggcgcggtgcagcgtttggcgcagatggcgcgtgctgcc
ggcatccatgttatcatggccacccagcgcccctccgttgatgtcatcaccggcacgatc
aaggccaacttcccgacacgcatctcattccaggtcacctcgaagatcgacagccgcacg
atccttggagagcagggcgccgaacagctgctcggcatgggtgatatgctttacatggcg
ggcggcggacgcatccagcgtgtgcacgggcccttcgtttccgacaatgaagtggaagag
atcgtttcctatctgaagacacaagggtcgcctgagtatctcgaagcgattaccgaagaa
gaagacgaggacggcgctggcgcaagcccggctggcggcgccagcttctcggattccgag
gacccctacgatcaggccgtggccgtcgtacttcgcgatggcaaagcctccacctcctat
gtgcagcgtcgtctcggcatcggttacaaccgcgcggcatcgctgatcgaacgcatggag
caggaaggcattatcggccccgccaaccacgccggaaaacgcgaaatcctcgttcccacg
gaagcagatatcatcgagcgctaa

DBGET integrated database retrieval system