KEGG   Rhizobium pusense IRBG74: BN877_II0049
Entry
BN877_II0049      CDS       T02867                                 

Gene name
ampC
Definition
(GenBank) Beta-lactamase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN877_II0049 (ampC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II0049 (ampC)
Enzymes [BR:rir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     BN877_II0049 (ampC)
SSDB
Motif
Pfam: Beta-lactamase
Other DBs
NCBI-ProteinID: CDI09850
UniProt: U4PXM7
LinkDB
Position
linear:complement(40495..41652)
AA seq 385 aa
MNFHRRHIVWTAMLSAILLTPALAADEARLKAITDAAIKPIMEKNGIPGLAVGISVDGES
YIFTYGVMSKSTGQPVTAETLFELGSISKTFTATLATYAEANGHLSLSGRVRDYLPGMKG
TAFGDVTLTHLGTHTAGGFPLQVPDNVKTETQLLAYLKSWKPSYGAGTHRTYANPSIGML
GYITAKAMGQGYDAAMQDTLFPALGLKDTFTVVPKAKLANYAQGYTRNDEPARLTPGILS
SEAYGVRSTATDMIRFVNANLGLEKLDGKIRQAIASTHTGYFAVGAMTQDLVWEQYARPV
ALKTLVQSNSGALLKNVPVQEIAPPLKPGQDVFINKTGSTNGFGAYVAFIPQRKLGIVIL
ANKNYPNEDRVTAAVEILTAVDKAD
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaattttcaccgcagacatatcgtatggacggccatgctttcggcgatcctcctcacg
ccggctctggccgccgacgaggcgaggctgaaggcgataacggatgcggcgatcaagccc
atcatggaaaagaacggcatacccgggcttgcggtcggcatcagcgtcgatggagagagt
tacatcttcacttacggcgtgatgtcaaaaagcaccggccagccggtgacggctgaaacg
ctgttcgaactcggctccatcagcaagacattcacggctacccttgcgacctacgccgag
gcgaacgggcatttgtcgctgtccggcagggtcagggattatcttccgggaatgaagggc
accgctttcggtgacgttacattgacgcatctgggcacccacaccgcaggcggctttccg
ctacaggtgcctgacaatgtcaaaacggaaacgcagctgcttgcttatctcaagagctgg
aagccttcttacggcgccggaacgcacaggacctacgccaatcccagcatcggcatgctg
ggctacatcacggcaaaggcgatggggcagggctacgacgccgccatgcaggacacgctc
tttcccgcgctggggctgaaggacacgttcacggtcgttcccaaggcgaagttggccaat
tatgcacagggctacacgcgaaacgacgagccggcccgcctgacgccgggcattctatct
tcggaagcctatggcgtcagatcgacggcgacagacatgatccgcttcgtcaacgcgaat
ctggggcttgaaaaactggacggcaagatccggcaggcgatcgcaagcacccataccggt
tatttcgcggtcggcgccatgacgcaggatctcgtctgggagcaatatgcccggcccgtc
gccttgaagacgcttgtccagtccaattccggcgcgcttctcaaaaacgttccggtgcag
gaaatcgcaccgcccctgaagcccggacaggatgtcttcatcaacaagacgggttccacc
aatggttttggtgcctatgtcgccttcatccctcaacggaaactcggcatcgtcatactg
gccaacaaaaactatcccaatgaggatcgtgtcacggcggccgttgagattttgacggct
gtcgacaaggcggactga

DBGET integrated database retrieval system