KEGG   Rhizobium pusense IRBG74: BN877_II0050
Entry
BN877_II0050      CDS       T02867                                 

Gene name
ampR
Definition
(GenBank) HTH-type transcriptional activator AmpR
  KO
K17850  LysR family transcriptional regulator, regulator of gene expression of beta-lactamase
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II0050 (ampR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rir03000]
    BN877_II0050 (ampR)
Transcription factors [BR:rir03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    BN877_II0050 (ampR)
SSDB
Motif
Pfam: LysR_substrate HTH_1
Other DBs
NCBI-ProteinID: CDI09851
UniProt: U4Q7X8
LinkDB
Position
linear:41784..42662
AA seq 292 aa
MVRQFLPLNGLRAFEASARHLSFTRAAIELCVTQAAVSQQVKGLEKRLGVALFQRLPRGL
KITAEGEALLPTVTSSFDQMATTLDRIEAGQVRELLFLGVVGTFAVGWLLPRLQAFQKRH
PFIDVRVSTNNNRVDMAAEGLDFAIRFGQGSWHGTDAFRLFDAPLSPLCTPKLAEMLKAP
ADLMEATLLRSYRADEWSSWFAAAGVTPAAQVNAGIVFDTSLGMMEAALQGLGVALAPPS
MFSRHLASGAVVQPFPVTISLGSYWLTRLQSKPPTPAMQVFSDWLFDSIRTA
NT seq 879 nt   +upstreamnt  +downstreamnt
atggtccgtcaatttcttcccctgaatggtttgcgcgcgttcgaagcttccgcgcggcat
ctgagctttacccgcgcggcgatcgaactatgcgtgacgcaggcggctgtgagccagcag
gtcaagggactggaaaagcggctgggcgtcgcgctttttcaacgtctcccgcgcggcctg
aagataactgcggaaggcgaagccctgctgccgacggtgaccagttccttcgaccagatg
gcaacgacgcttgaccgcatcgaggccgggcaggtgcgcgaactgctgtttctcggcgtt
gtcggcaccttcgcggtcggctggctgctgccgcgcctgcaggcgtttcagaagcgccac
ccctttattgacgtcagggtttccaccaacaacaaccgggtggatatggcggcagagggg
ctggatttcgccattcgtttcggtcagggctcgtggcacggcacggatgcgtttcgtctc
tttgacgcgccgctttcgccgctgtgcacgccgaaactggcggaaatgctgaaagcgccg
gccgacctgatggaagcgacattgctgcgcagttaccgcgccgatgaatggagcagctgg
tttgcggcggcgggcgtcacgccggccgcacaggtcaatgccggcattgtcttcgacacg
tcgctcgggatgatggaggccgccctgcaagggctcggtgtcgcgctggcgccgccgtcg
atgttttcacggcatctggcttccggagcggtcgtccaaccttttcccgtcaccatatcg
ctcggaagctattggttgacccggctgcaatcgaaaccgccgaccccagccatgcaggtc
ttttccgactggctgttcgacagcatccgcaccgcttga

DBGET integrated database retrieval system