KEGG   Rhizobium pusense IRBG74: BN877_II0188
Entry
BN877_II0188      CDS       T02867                                 

Definition
(GenBank) Putative component of multidrug efflux pump, acrB/acrD/acrF family
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II0188
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_II0188
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_II0188
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_II0188
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_II0188
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_II0188
Transporters [BR:rir02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   BN877_II0188
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    BN877_II0188
SSDB
Motif
Pfam: HlyD_D23 HlyD Biotin_lipoyl_2 HlyD_3
Other DBs
NCBI-ProteinID: CDI09989
UniProt: U4PYA0
LinkDB
Position
linear:complement(177028..178218)
AA seq 396 aa
MAKRLGQIVAVLLGGIVVVGCSDEQASAPGAPPPGAVKVVTVKQEELPITNDLPGRIAPT
RLAEVRPRVSGIIVERVFEQGSLVKEGDVLYRIDPAPFQVRVDSAEGTLRRAQAAQLQAR
QTADRQQQLRRSNVGSQQEFDNAIAQLAQADAEVAVAEAGLAEAKLNLQYADVKAPISGR
IGRARITEGALVSATGSENLATIQQLDPIYADFTQPAADLIRLRKALQDGKLMTGPNEAE
VNLLFDDGSRYPQPGRLLFSEAAVDETTGQVTLRGEFPNPNGDLLPGMYVRVQIQQGIQK
AAFAVPQQAVQRDAGGQASVLVVNAEDTVEQRRVSVGRSIGDRWVISEGLKDGDRVVAEG
FQKTAPGAKVKPEPWSDEADVAAAAGSESAAPAQKQ
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggcgaaaagactggggcagatcgtggcggtgttgttggggggcatcgttgtggtcgga
tgtagcgacgagcaggcgtctgcccccggcgcgccgccgcctggtgcagtcaaggtcgtg
accgtaaagcaggaagagctgccgataaccaacgacctgccgggccgcattgcaccgacg
cgacttgcggaagtgcgcccgcgtgtctcaggcatcatcgttgagcgcgtgttcgagcag
ggttcgctggtgaaggaaggcgatgtcctctaccgcatcgatcccgccccgttccaggtg
cgcgtcgacagcgccgagggcacgttgcgccgggcgcaggccgcgcagcttcaggcgcgc
cagacggccgacaggcagcagcagctgcgccgttccaacgttggttcgcagcaggaattc
gacaatgccattgcccagctggcgcaggccgatgccgaggtggcggtggctgaggcaggc
ctggcggaagcgaagctcaatcttcaatatgccgatgtcaaagccccgatcagcggccgg
atcggccgcgcgcgtattacggaaggcgcgctcgtcagcgcgaccggctctgaaaacctg
gcgacgatccagcagcttgatccgatctatgccgacttcacccagccggcggccgatctc
attcggctgcgcaaggcgcttcaggacggcaagctgatgaccggtccgaatgaagccgaa
gtcaatctgctcttcgatgacggcagccgttacccgcagcccggccgtctgctgttttcg
gaggcggcggtggatgagaccaccggccaggtaacgctgcgcggcgaatttcccaacccg
aacggcgatctgctgccgggcatgtatgtccgcgtgcagatccagcagggcattcagaag
gccgcattcgcggtgccgcagcaggcggttcagcgcgatgccggcggtcaggcgagcgtg
cttgtcgtcaacgccgaagatacggtcgagcagcggcgcgtcagcgtcggccgttccatc
ggtgaccgctgggtgatttcggaagggctgaaggatggcgaccgcgttgttgccgaaggc
ttccagaagaccgccccgggagccaaggtgaagcctgaaccctggtccgacgaggccgat
gtcgccgctgccgcaggtagcgagagcgcggctccggcccagaagcaataa

DBGET integrated database retrieval system