KEGG   Rhizobium pusense IRBG74: BN877_II0610
Entry
BN877_II0610      CDS       T02867                                 

Gene name
ftsE
Definition
(GenBank) Cell division ABC transpoter (ATP-binding protein)
  KO
K09812  cell division transport system ATP-binding protein
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN877_II0610 (ftsE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_II0610 (ftsE)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_II0610 (ftsE)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_II0610 (ftsE)
Transporters [BR:rir02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Cell division transporter
    BN877_II0610 (ftsE)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_22 AAA_29 AAA_25 AAA_33 AAA_23 SMC_N RsgA_GTPase Zeta_toxin AAA_30 AAA AAA_18 cobW TsaE AAA_5 NACHT ATPase_2 NTPase_1 T2SSE PIF1 AAA_28 FtsK_SpoIIIE APS_kinase
Other DBs
NCBI-ProteinID: CDI10410
UniProt: A0A1L9CZJ0
LinkDB
Position
linear:622194..622853
AA seq 219 aa
MIHFENVGLRYGMGPEILRDMTFDIPKGSFQFLTGPSGAGKTTLLRLLLMSLQPTRGNIR
MFNRDVSRIPRSELPMLRRRVGIVFQDFRLLDHLTTYENVALPLRVRGKEESAYRNDVIE
LLKWVGLGERVNVLPAILSGGEKQRAAIARALMDQPEILLADEPTGNVDPPMAKRLLNLF
LELNRLGTAVVIATHDFGLMDQIDARRMILTEGRLDIYE
NT seq 660 nt   +upstreamnt  +downstreamnt
ttgatccatttcgaaaatgtcgggttgcgttacggcatgggacccgaaatcctgagggac
atgaccttcgatattcccaaagggtcgttccagtttctgaccggcccctcgggcgccggc
aagacaacgctgctgcgcctgctactgatgtcgctgcagccgacccgcggcaatatccgc
atgttcaatcgcgatgtgtcacgcattccgcgcagcgagctgccgatgttgcgccggcgc
gtcggcattgtctttcaggatttccggctgcttgatcatctgacgacctatgagaatgtc
gccctgccgctgcgcgtgcgtggcaaggaagaaagcgcctatcgcaatgacgtgatcgag
cttctgaaatgggttgggctcggcgagcgtgtcaacgtgctgccggcgatcctttccggc
ggcgagaagcagcgcgccgccattgcccgcgcgctgatggaccagccggaaatattgctg
gccgacgagccgaccggcaatgttgatccgccgatggccaagcgccttctcaacctgttt
ctggaactcaaccggctgggcaccgccgtcgttatcgccacccatgacttcggcctgatg
gaccagatcgatgcgcgccggatgatcctgaccgaagggcggctcgacatctatgaatga

DBGET integrated database retrieval system