KEGG   Rhizobium pusense IRBG74: BN877_II0611
Entry
BN877_II0611      CDS       T02867                                 

Gene name
ftsX
Definition
(GenBank) Cell division ABC transporter (membrane component)
  KO
K09811  cell division transport system permease protein
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN877_II0611 (ftsX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_II0611 (ftsX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_II0611 (ftsX)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_II0611 (ftsX)
Transporters [BR:rir02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Cell division transporter
    BN877_II0611 (ftsX)
SSDB
Other DBs
NCBI-ProteinID: CDI10411
UniProt: U4Q9K7
LinkDB
Position
linear:622846..623853
AA seq 335 aa
MNEITRKPLKPEAAQPKRPPMRIRPMAPILPPSNIQGNALMVVIAIMAFLACLTLGAVSM
VRATAATWQSQISREITIQIKPEDGLDMNAALNKVRNLALTFVGTRDGTILDDAATSRLL
EPWLGSGLDLSELPIPRLVVITIDENNPPDFQAMRDMLKAEIPQAFLDDHRTWVDRLVSM
ARTTVMIGVGVLVLVFTAMVLTVVFATRGALSGNRHIVEVLHFVGAESSFVAREFQKHFL
KISLKGAAAGSALAAAVFLVAGFWQSSTVATPQSDQASALFGSFSVGLGGYFGIAMTMII
IALLTTITARVTVIRTIDDIDRVRSDPSKSDGLAS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaatgagatcacccgcaaaccgttgaagccggaagcggcgcagccgaagcgtccgccc
atgcgcatccgcccgatggcacccattctgccgccctccaacattcagggcaatgcgctg
atggtggtcatcgccatcatggcttttctcgcctgcctcacgctcggcgccgtttccatg
gtgcgcgccaccgccgccacgtggcagagccagatttcccgtgagatcaccatccagatc
aaacccgaggacgggctggacatgaatgcagcgctgaacaaggtgcgcaatctggcgctc
accttcgtcggcacccgcgatggcaccattcttgacgatgcggcgacatcgcgcctgctg
gagccgtggctcggcagcgggctcgatctctccgaacttcccataccgcgtctcgtcgtc
atcaccatcgatgaaaacaatccgcccgatttccaggcgatgcgggatatgctgaaggcc
gagattccacaggcatttctggacgaccatcgcacctgggtcgaccggctcgtttccatg
gcaagaaccactgtcatgatcggcgttggcgtcctcgttctcgtgttcacagccatggtg
ctgactgtcgtatttgccacccgcggcgcgctttccggcaatcggcacattgtcgaggtt
ctgcattttgtcggcgcggagagcagcttcgtggcgcgggaattccagaaacacttcctg
aagatcagcctcaagggcgcggcagcgggcagtgcgctggcagccgccgtgttcctcgtc
gccggtttctggcagtcgagcaccgtcgccaccccccagagcgatcaggcaagtgcgctt
tttggctccttttccgtcggccttggcggttatttcggcattgcgatgacgatgatcatc
atcgcgcttctcaccaccatcaccgcacgcgtcaccgtcatccgcaccatcgacgatatc
gatcgcgtccggtccgatccgtcgaaaagcgacggcctggcatcgtga

DBGET integrated database retrieval system