KEGG   Rhizobium pusense IRBG74: BN877_II0681
Entry
BN877_II0681      CDS       T02867                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K09888  cell division protein ZapA
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_II0681
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_II0681
SSDB
Motif
Pfam: ZapA Cep57_CLD_2 DHR10 NPV_P10 DUF677 DUF1192 ABC_tran_CTD
Other DBs
NCBI-ProteinID: CDI10479
UniProt: A0A1L9D0X5
LinkDB
Position
linear:complement(692714..693091)
AA seq 125 aa
MAQVTVMIDGKAYRMACEAGQEDHLTDLATRFDRYVGHLKSQFGEIGDLRLTVMAGIMVM
DELSELNRKIEKLEGEVASLSRNRDGMAEHKAKSDEMVALAIGDLADRLNGITEKLLDRP
KPAAH
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcgcaagttactgttatgatcgacggaaaggcctatcgcatggcgtgcgaagcaggc
caggaagaccacctgaccgaccttgccacccgtttcgaccggtatgtggggcatctcaag
agccagttcggagagatcggcgacctgaggctaacggtaatggctggtatcatggtgatg
gacgagctttccgagctcaaccgcaagatcgagaagctggaaggtgaggtcgcatccctc
tcccgcaatcgcgatggcatggccgagcacaaggcgaagtcggatgagatggtggcgctt
gccatcggcgatctggccgaccggctgaacggcattaccgaaaaattgctggaccgccca
aaaccggcggcacactga

DBGET integrated database retrieval system