KEGG   Rhizobium pusense IRBG74: BN877_II1058
Entry
BN877_II1058      CDS       T02867                                 

Definition
(GenBank) putative oligopeptide transport protein (ABC superfamily, atp_bind)
  KO
K10823  oligopeptide transport system ATP-binding protein
K15583  oligopeptide transport system ATP-binding protein
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir02010  ABC transporters
rir02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN877_II1058
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN877_II1058
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II1058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_II1058
Transporters [BR:rir02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BN877_II1058
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N oligo_HPY AAA_29 AAA_16 AAA_22 DUF87 DO-GTPase2 NACHT RsgA_GTPase AAA_5 ATP-synt_ab MMR_HSR1 AAA_23 AAA_30 AAA_15 FtsK_SpoIIIE ABC_ATPase AAA_13 PRK AAA_18
Other DBs
NCBI-ProteinID: CDI10849
UniProt: U4Q0S5
LinkDB
Position
linear:complement(1091215..1092825)
AA seq 536 aa
MKTTTDTILSVRDLKVDFTTPDGTVHAVKGIDLDVKQGETLAVVGESGSGKSQTMMGIMG
LLASNGAISGSAKYRGKELLGLPVGELNKIRGAKVTMIFQEPMTSLDPLYRIGAQIAEPI
IHHRGGSKKEARARVLELLRLVGIPEPERRIDSYPHELSGGQRQRVMIAMALANEPDILI
ADEPTTALDVTIQAQILDLLKSLQQRFGMAIVLITHDLGVVRHFADRVAVMRRGEIVEAG
TTEDIFVRPKADYTRMLLDAEPRGNKPVVSREAPIVLSGQNVTIDYTIPGGFLSKSSKFR
AVDGVNVNLHQGQTIGIVGESGSGKSTLGRALLRLIQADGRIFFGKQEITGLDRKAMRPL
RRHLQLVFQDPYGSLSPRQTVGEIITEGLFVHDRDLNRAERDRRAIEALKEVGLDPAARN
RYPHEFSGGQRQRIAIARAIILKPEVIILDEPTSALDRSVQGQVIDLLRDLQKAHGLSYI
FISHDLSVIKAISDYVIVMRNGKIVEEGETNAIFNRPSAEYTRTLIKSAFSPAVVP
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgaagacgacaactgacaccattctttccgttcgcgacctcaaggtcgatttcaccacg
ccggatggcactgtccatgccgtcaagggcatcgaccttgacgttaaacagggtgaaacg
ctcgctgtggttggcgagtccggttctggcaaaagccagacgatgatgggcatcatgggg
ttgcttgcatccaatggcgccatcagcggctcggcgaaatatcgcggaaaggaacttctt
ggactgcctgtcggcgagcttaacaaaatccgtggcgcgaaagtcaccatgatcttccag
gagccgatgacctcgctcgatcctctctaccggatcggtgcgcagattgccgagccgatc
attcaccaccgcggtggcagtaaaaaggaggcgcgcgcacgcgttctcgaactgctgagg
ctcgtcggaattccggagcccgagcggcgtatagacagctatcctcacgagctttccggt
ggtcagcgccagcgcgtcatgatcgccatggcgctcgcgaacgagccggacatcctgatt
gcggatgaaccgaccaccgccctcgacgttacgatccaggcccagatccttgatcttttg
aagtcgctgcagcagcgtttcgggatggcgatcgtgctgatcacgcatgatctcggtgtc
gtccgccactttgccgatcgcgtcgcggtcatgcgacggggggaaatcgtggaggctggg
accacggaggatatcttcgtgcgcccgaaggcggattatacccggatgcttctcgatgcc
gagccccgagggaacaagcctgtagtcagccgagaggctccgatcgtgctttccggccag
aacgtaacgatcgattacacaattccgggcggcttcctgtcgaaatcgagcaagttccgg
gccgttgatggcgtgaacgtcaatcttcatcagggacagacgatcggcattgttggcgaa
tccgggtcaggcaaatccacgctcggtcgcgctctgctgcgcctgatccaggccgatggc
cggattttcttcggaaaacaggaaatcaccgggcttgatcgaaaggccatgcggccgcta
cggcggcatctccagctcgtgttccaggacccctatggttcgctttcgccgcgacagaca
gtaggcgagatcatcaccgaggggctcttcgtccacgaccgggacctcaaccgtgcggaa
cgggacaggcgcgcaatcgaggcgctgaaggaagtcggcctcgatcccgccgcccgcaac
cgctatccccatgaattttccggggggcaacgccaacgtatcgccattgcccgcgccatt
attctcaaaccagaggtcatcattcttgacgaacccacgtcggcgctggaccggtccgtt
cagggccaggttatcgacctcctgcgtgatctacagaaggcccacggcctttcctacatc
ttcatcagccacgacctgtccgtcatcaaggccatttcagattacgtcatcgtcatgaga
aacggaaagattgtcgaggagggagagacaaacgccatcttcaaccggccttcggctgag
tacaccagaacactgatcaaatccgctttttcgcccgccgtcgtgccgtag

KEGG   Rhizobium pusense IRBG74: BN877_II1059
Entry
BN877_II1059      CDS       T02867                                 

Definition
(GenBank) ABC-type dipeptide/oligopeptide/nickel transport system, permease component
  KO
K15582  oligopeptide transport system permease protein
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir02010  ABC transporters
rir02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN877_II1059
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN877_II1059
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II1059
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_II1059
Transporters [BR:rir02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BN877_II1059
SSDB
Motif
Pfam: BPD_transp_1 OppC_N Phage-tail_3
Other DBs
NCBI-ProteinID: CDI10850
UniProt: U4Q0I9
LinkDB
Position
linear:complement(1092827..1093975)
AA seq 382 aa
MIRGSDMTDSPGTNPHSQQIKSRSLFQLAVLRFRRNKAAMAGSVMLLLITLFSFVGPHFL
AHTYDQVFSSYVSVAPSLEPRPDVNNLQDVMEGVASRARVELKEFAVEGQTFTATITSSS
AIDPRATRYFDRANEFKNTKVTATEDDGRTLKLEGDVNREYFFFGTDSNGRDMLARVMLG
GQISIAVGVLASLVSLGIGVVYGATAGYIGGRVDNVMMRFVEILYSLPFVFLVVVLVVFF
GRSFILIFLVIGAVEWLDMARIVRGQTLALKRREFVSAAQALGLSDWQIIRRHIIPNTIG
PVVVFVTVVVPKVILLESFLSFLGLGVQAPLTSWGALISEGANNIQSAPWLLIFPAIFFV
LTLFSLNFVGDGLRDALDPKDR
NT seq 1149 nt   +upstreamnt  +downstreamnt
ttgatccgagggtcagacatgactgatagccccggcactaaccctcattcgcaacaaatc
aaaagccgcagcctgttccagctggcagtcctgcgtttcagacgcaacaaggcagccatg
gcgggttccgtcatgttactccttatcactctgttctcgttcgtcgggcctcatttcctg
gcgcacacctatgatcaggtgttttcctcctatgtctcggtggcacccagtctcgagcca
cgccctgatgtgaataaccttcaggacgtgatggagggtgttgcgagccgggcccgcgtc
gagctgaaggaatttgccgttgaaggccagactttcacggcgaccatcacctccagcagc
gcaatcgatccgcgcgcaacacgctacttcgaccgtgccaatgaattcaaaaataccaag
gtgactgcgaccgaagacgacggacgcacgctgaagctggaaggcgacgtcaaccgcgaa
tactttttcttcggtacagattccaacggccgcgacatgcttgcgcgcgtcatgcttggc
ggtcagatttcgattgcggtcggtgtcctggcgagcctcgtttccttgggaatcggcgtg
gtctacggtgcaacagcgggctatattggagggcgcgtggacaatgtgatgatgcgcttc
gtcgaaatcctctattcactccccttcgtctttctggttgtggttctggtcgtctttttt
ggccgcagcttcatcctgatcttcctcgtcatcggcgcggtggaatggctggacatggcg
cgcatcgtgcgtggccagacactcgccttgaaacgacgggaatttgtcagtgcggcgcag
gctctggggctaagcgactggcagattatccgccgtcatatcatccccaatacgatcggg
cccgttgtcgttttcgtgacggtcgtcgtgcccaaagtcattcttctggaaagcttccta
tccttcctcggtctcggcgttcaggcgccgttgacaagctggggagcgctgatttccgaa
ggtgccaacaatatccagtccgccccgtggcttctgatattcccggcgatctttttcgtg
ctgaccctgttttcgctgaatttcgtcggcgatgggttgcgtgatgcactcgatcccaag
gatcgttga

KEGG   Rhizobium pusense IRBG74: BN877_II1060
Entry
BN877_II1060      CDS       T02867                                 

Gene name
oppB
Definition
(GenBank) oligopeptide transporter subunit; membrane component of ABC superfamily
  KO
K15581  oligopeptide transport system permease protein
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir02010  ABC transporters
rir02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN877_II1060 (oppB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN877_II1060 (oppB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II1060 (oppB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_II1060 (oppB)
Transporters [BR:rir02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BN877_II1060 (oppB)
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N Trep_Strep DUF2897
Other DBs
NCBI-ProteinID: CDI10851
UniProt: U4QAU3
LinkDB
Position
linear:complement(1093950..1094873)
AA seq 307 aa
MISFILRRLASAVPTLFIVVTISFFLMRFAPGGPFNLERPLPPQTMENLLRTYHLDEPLW
RQYLIYLGNAVTGDFGPSYIYKDNTVAQLIGKGLPYSLELGCYALLLALVGGVLAGTLAA
LRQNSAFDFSIMSISTVGVTVPNFVVAPVLTLVFAVLLGLLPAGSWGDGSLRYLILPMIA
LALPQLAVIARLTRGAMIEALRMDHIRTAKAYGLPARSVVVFHAMRAAMLPVVSYLAPCA
AALLTGSAVIETIFTIPGVGRYFVLGAINRDYTLVMGTVVLIAIFVILFNLVVDILYGLL
DPRVRHD
NT seq 924 nt   +upstreamnt  +downstreamnt
atgatctcgtttattctgcgccgtttggcgagcgccgtgccgacgttgtttatcgtcgtc
acgatctcgtttttcctgatgcgttttgcgcccggtggtccgttcaatctcgaacgtccc
ctccccccgcagaccatggaaaatctgttgagaacctatcatctggatgagccactatgg
cgccagtatctcatctatctcggcaatgccgtcactggcgattttggcccaagctacatc
tataaggacaacaccgtcgcgcagctgatcggcaagggcctgccctattcgctcgaactg
ggttgttatgccctgttgctggctctggtgggcggcgtgctcgccggcacgctcgcagca
ctcaggcaaaacagcgctttcgatttctcgatcatgtcaatctcgacagtgggcgtcacc
gtcccgaacttcgtcgtggcccctgttctcacgcttgtatttgccgtgctgctcgggctt
cttccggcaggcagctggggtgacgggtcgctacgctacctcattcttccgatgatcgca
cttgcgctgccgcagcttgcggtcattgcccggctgacgcgcggtgccatgatcgaggca
ctgcgaatggaccacatccgcacggccaaggcctatggccttcccgcgcgcagcgtcgtc
gttttccacgccatgcgcgcggcaatgctgccggtcgtttcctatctcgctccctgcgcc
gccgcgcttttgactggctcggcagtcatcgaaacgatcttcaccattcccggtgtcggc
cgctacttcgttctcggcgccatcaatcgtgactatacgctggtgatgggcaccgttgtt
ctcatcgccattttcgtcatcctgttcaatctagtcgtcgatattctctacggccttctt
gatccgagggtcagacatgactga

KEGG   Rhizobium pusense IRBG74: BN877_II1061
Entry
BN877_II1061      CDS       T02867                                 

Definition
(GenBank) ABC-type oligopeptide transport system, periplasmic component
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir02010  ABC transporters
rir02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rir00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN877_II1061
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN877_II1061
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II1061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_II1061
Transporters [BR:rir02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BN877_II1061
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-ProteinID: CDI10852
UniProt: U4QEK7
LinkDB
Position
linear:complement(1094925..1096520)
AA seq 531 aa
MSINARSRVAVVMAALLLGASSALAETVLHRGNAGEPQTLDQAQTSINIEAFIVKDLYEG
LTIYDATGKIIPGTAESWTLSDDGTVYTFKLRADAKWSDGTPVTAEDFVFSYKRVEDPKT
AAKYANILYPIKNAEKINKGETPVDQLGVKAVDDKTLEITLERPTPFFLELLAHQTALPI
SKASYEKNGADFVKPGVMVSNGAYKLEAHVPNDSLTVVKNTNFWDAANTKIDKVIFYPVD
DQAASVRRFEAKEMDLAYNFSADQIDRLRKSYGDQVHVSPTLATYYYTFDTREAPYDDVR
VRRALSMAVDREFLAKEIYSGSQVPAYSMVPPGMDSYGEPATADFAALSQLDREDEALKL
MKEAGYGEGGKPLSIEIRYNTNPNHERVATAIADMWKNTFGAKVSLVNLDVASHYGYLQE
GGKFNVARAGWVADYADAENFLALSISSNKTFNYSKFNNAEYDALLKKSYEERDPAARSK
LLHEAETILMKEQPVAPLLTQADLWLVSNRVKGWVDNAANQHLSRFLSVSE
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtcgataaatgctaggtctcgggtcgcggtggtgatggctgcgcttctcttgggggcg
agctctgcgcttgcagaaacagtgttacaccgcggtaatgccggcgaaccacagacgctc
gatcaggcacagacctccatcaacatcgaggccttcatcgtcaaggatctctatgaaggt
ctgaccatctatgacgcgaccggcaagatcattccgggcacggccgaaagctggacgctg
tctgacgatggtaccgtttacacgttcaaactgcgcgccgatgcgaagtggtcggacggt
acacccgtgacggcggaagattttgtcttctcttataagcgcgtcgaagacccgaagacc
gcagcgaaatacgccaatattctctacccgatcaagaacgccgaaaagatcaacaagggc
gaaacgcctgttgaccagcttggcgtcaaggcggtggatgacaagaccctggagatcacg
cttgagcggccgacgccgttcttccttgaactgctcgcccatcaaacggctctgcccatt
tccaaggcgagttacgaaaagaacggcgcggatttcgtgaaaccgggcgtgatggtgtcg
aacggcgcctacaaactcgaagctcatgttccgaacgacagcctcactgtggtcaagaac
accaatttctgggatgctgccaataccaagatcgacaaggtgatcttctacccggttgac
gaccaggccgcctccgttcgccgtttcgaggcgaaggaaatggacctcgcctacaatttt
tcagctgaccagatcgaccgtctgcgcaaatcctatggcgaccaggtgcacgtttcaccg
acgctcgcgacctactactacaccttcgatacgcgcgaagcgccatatgacgacgtccgc
gtgcgccgggcgctatccatggctgtcgaccgcgaattcctcgccaaggaaatctacagc
ggctcgcaagttcccgcctattcgatggttcccccgggcatggattcctacggtgagccc
gccacggccgactttgcagccctgtcgcagcttgatcgcgaagacgaagctctaaagctc
atgaaggaggccggttacggtgaaggtggcaagcctttatccatcgaaatccgttacaat
accaaccccaaccacgaacgcgttgcgaccgccattgccgacatgtggaaaaacaccttt
ggcgccaaggtctccctcgtgaacctcgacgttgcctcgcactacggctacctccaggaa
ggcggcaagttcaatgtggcgcgtgctggctgggtcgctgactatgcggatgcggaaaac
ttccttgcgctctccatctcgtccaacaagaccttcaattactcgaagttcaacaacgcc
gagtatgatgcattgctgaagaagtcctatgaggaaagggatccggcagctcgctccaag
ctgctgcacgaggccgaaacgatcctcatgaaggaacagccggtagcgccgcttctgaca
caggccgatctttggctggtgtccaaccgcgtcaagggttgggtggacaacgctgccaat
caacacctcagccgcttcctgagcgtttccgaataa

DBGET integrated database retrieval system