KEGG   Rhizobium pusense IRBG74: BN877_II1115
Entry
BN877_II1115      CDS       T02867                                 

Definition
(GenBank) Signal transduction histidine kinase
  KO
K18143  two-component system, OmpR family, sensor histidine kinase AdeS [EC:2.7.13.3]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II1115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rir01001]
    BN877_II1115
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rir02022]
    BN877_II1115
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_II1115
Enzymes [BR:rir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BN877_II1115
Protein kinases [BR:rir01001]
 Histidine kinases
  OmpR family
   BN877_II1115
Two-component system [BR:rir02022]
 OmpR family
  AdeS-AdeR
   BN877_II1115
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AdeABC [MD:M00649]
    BN877_II1115
SSDB
Motif
Pfam: HATPase_c HisKA HAMP Frag1 Sigma_reg_N
Other DBs
NCBI-ProteinID: CDI10906
UniProt: U4QB38
LinkDB
Position
linear:complement(1153269..1154426)
AA seq 385 aa
MKPWRLRLRTMTAITITTMLIFAVALVYFGVSWYADNIQERMIAQLSPDASKAFSDIDRG
VMPDQRQLEALVRVLPGLEDEADNELIKSVFIFGLLGVFLCSLLGYFISRRIAAPLGELA
DAARRMATGNFSGGAEIRGSHIAEVAFLVDSFESLIRELQMMEHRLKFNTMAVAHELRTP
LTILQGRLHGIADDLFPLDKEAIRHLIVHVEGLARLVDDLRTLSLAETNSLVKDTEPLDL
AAECAAVAEAARPLMNEAGIDLEMSLEAASVCGDRQRLRQLLLILMDNVRRYAASGGFMR
CSTGLQDGRAFVSIEDKGPGFPAGVEAHGIELFWRMEPSRARKTGGTGLGLSIARAIAQA
HDSDLQIKARPDGGTIVTVIFREAS
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaagccttggcggctccgcctgcggacgatgacggcgatcacgatcactacaatgctc
atctttgcggttgcgttggtctatttcggcgtttcctggtatgcggacaatattcaggag
cgcatgatcgcccagctatcgccggatgcctccaaggccttctcggatatagaccggggt
gtgatgccagaccagcgtcagcttgaggcccttgtcagggttttgccgggcctcgaggac
gaggccgataacgagcttatcaaatccgtgttcattttcggattgctcggtgtctttctc
tgcagcttgcttggttacttcatctctcggcgcattgcggcacctctaggcgaacttgcc
gatgcagcgcggcgcatggcgaccggcaacttcagcggaggagcagagatcagggggagc
cacatcgcagaggtcgcatttctcgtcgacagtttcgagagcttgatccgggaacttcag
atgatggagcaccggttgaagttcaacacgatggcggtagcccatgaactgcgcaccccg
ctcacgatcctgcagggccgtttgcacggcattgccgatgatctctttcccctcgacaag
gaagccattcgccacctcatcgtccatgtggaggggctggcacgtctcgtggatgatttg
cgcacgctttctctggccgaaaccaacagcctcgtcaaagacaccgagccacttgatctt
gccgccgaatgcgcggccgtggcggaggcggcacggccgctcatgaacgaagcaggcatt
gatctcgagatgtcgctggaggcagcatcagtttgcggcgaccgtcaacgccttcggcag
ctgctgctgatcctgatggacaatgtgcgccgctacgcggcgagcggcggatttatgcgt
tgttcgaccgggcttcaggacgggcgcgccttcgtctcgatcgaggataaagggccgggc
ttccccgccggcgtcgaggcgcacggcatcgaactcttctggcggatggaaccgtcacgc
gcgcgtaagaccggcgggacaggtctcggcctgtccattgcccgcgcaatcgcacaggcg
catgacagcgatctgcagataaaggcgcgcccggacggcggaacgatcgtgaccgtcatt
ttccgggaggcatcctga

DBGET integrated database retrieval system