KEGG   Rhizobium pusense IRBG74: BN877_II1116
Entry
BN877_II1116      CDS       T02867                                 

Gene name
ycf
Definition
(GenBank) putative transcriptional regulator ycf27
  KO
K18144  two-component system, OmpR family, response regulator AdeR
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II1116 (ycf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rir02022]
    BN877_II1116 (ycf)
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_II1116 (ycf)
Two-component system [BR:rir02022]
 OmpR family
  AdeS-AdeR
   BN877_II1116 (ycf)
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AdeABC [MD:M00649]
    BN877_II1116 (ycf)
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: CDI10907
UniProt: U4QEU6
LinkDB
Position
linear:complement(1154423..1155121)
AA seq 232 aa
MDKGLILIVEDDPDIIQILDAYLVREGYRTVRASDGETALTHFSMLRPDLVLLDIRLPKF
DGIEVLNRIRRERETPVIMVTSLAEDMDKLTGLRLGADDYIVKPFNPHELIARVNAVLKR
TRQPGSGGVLRFGPIEVDTEAYVAAVCNDGQRAVLPLTLSEFRILAHMARRPTHAFQRAD
ILDACLPESDALARTIDTHIANLRKKLTDHGACGYLVSVRSIGYRLAGEQKP
NT seq 699 nt   +upstreamnt  +downstreamnt
atggacaaaggactaattctaatcgtcgaagacgaccccgatattattcagatcctggac
gcctatctcgttcgcgaaggatacagaaccgtcagagccagcgacggagaaacggcgctg
acccatttctccatgttgagacctgatctggttctcctcgacattcgcctgccgaaattc
gacggcatcgaggttttgaaccgcatccggcgggaacgggagacgcctgtcatcatggtc
acatctctcgccgaggacatggacaagctgacgggccttcgcctcggcgctgacgactac
atcgtcaaacctttcaatccgcatgaattgatcgcgcgggtgaatgccgtgctgaaacgc
acgcggcaaccgggctctggcggggttttacgcttcgggcccattgaggtagacaccgaa
gcctatgtcgcagccgtctgcaacgacggtcagcgggccgttctgccgctcacgctgagc
gagttcaggatcctcgcccatatggcgcgtcgtcccacccacgcctttcagcgtgccgat
attcttgacgcctgcctgccggaaagcgatgcgctggcgcgcaccatcgacacacacatt
gccaatctgcgcaaaaaactgacggaccatggcgcctgcggttatctcgtctcggtgcgc
agcatcggttatcggctggcaggggagcaaaaaccatga

DBGET integrated database retrieval system