KEGG   Rhizobium pusense IRBG74: BN877_II1146
Entry
BN877_II1146      CDS       T02867                                 

Definition
(GenBank) conserved membrane protein of unknown function
  KO
K03760  lipid A ethanolaminephosphotransferase [EC:2.7.8.43]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00540  Lipopolysaccharide biosynthesis
rir01100  Metabolic pathways
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BN877_II1146
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_II1146
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rir01005]
    BN877_II1146
Enzymes [BR:rir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.43  lipid A phosphoethanolamine transferase
     BN877_II1146
Lipopolysaccharide biosynthesis proteins [BR:rir01005]
 Lipid A
  BN877_II1146
SSDB
Motif
Pfam: Sulfatase EptA_B_N CD225
Other DBs
NCBI-ProteinID: CDI10937
UniProt: U4QEX8
LinkDB
Position
linear:complement(1181009..1182664)
AA seq 551 aa
MALFTAKATGTTTYRPEIGSVALSLLTAAYLLFFTNRTFWSKVHTYLSAYPVAIVALYVA
MIAFFGALITIFSAKYLLRPFLIVLIFAAAAASWFMDRYGIVIDSDMIRNAMETTQAEAG
NLITPGFLWHMAIYGLVPSLVVVAVRIRHRPILDKLLWNTISILVCLAITGIISFANSKT
FTTAIRQHKDIVKSVNPLSPIMSTVHYFTQAGKEVDIQVSPIGKDAKVLPALGNVHKPRI
TVIVAGETARAANFSLNGYGRETNPELKKRDVVYFPSTTSCGTATAISIPCMFSQFTRSQ
YSHKKALANENVMDVLVHAGVSATWLDNNTGSKDVADRIPYFDLPSTNDSRFCTGGECRD
DIFFDKLDAWLDNVKKDSVIVLHQMGSHGPTYYLRYTDEFRKFTPDCRTAELGNCSDAEI
VNSYDNTLLYTDHFLSTVIDKLKARSDKLATGMIYASDHGESLGENGVYLHGAPYLLAPD
QQTHVPFLVWFDDDFAKSMGLDKACLAKSAAEGGRSHDNYFHSILGMMNVSTSVYDPSLD
VFSGCTQRRTS
NT seq 1656 nt   +upstreamnt  +downstreamnt
gtggctctttttaccgcgaaagcgacgggaacaacaacttatcgtccggaaatcggcagc
gtggcgctgagcctgctgacggcggcttatctcctgtttttcacgaaccggacattctgg
tcgaaggttcatacctatctttccgcctatccggtcgccatcgtcgcgctctatgttgcc
atgatcgcctttttcggcgcgctcatcacgattttctccgccaaatatctcctcaggccg
tttctgatcgtcctgatcttcgcggcggcggcggcgtcctggttcatggatcgctacggt
atcgtcatcgacagcgacatgatccgcaacgccatggagacgacgcaggcggaagcgggc
aatctgatcacgcccggctttctctggcatatggcgatttacgggctggtgccgtctctc
gtcgtcgtcgccgtccgcatccggcaccggccgatcctcgacaagcttctgtggaacacg
atcagcatcctggtctgccttgccataaccggcatcatcagcttcgccaactccaagacc
ttcaccaccgccattcgccagcacaaggatatcgtcaagagcgtcaatccgttgtcaccg
atcatgtcgacggtgcattatttcacgcaggccggcaaggaagtcgatattcaggtcagc
ccaatcggcaaggacgccaaagtcctgcccgcattgggtaacgtgcataagccacgcatt
accgtcatcgttgcgggcgaaactgcccgcgcggcgaatttttcgctgaatggctacggg
cgggaaaccaatccggagctcaagaagcgcgatgtggtctatttccccagcacaacgagc
tgtggcaccgcgacggcgatttccattccctgcatgttctcgcaattcacacgctcgcaa
tatagccacaagaaggcgcttgcgaatgaaaatgtcatggatgtcctcgtccatgcaggg
gtcagcgcgacctggctggacaataataccggtagcaaggacgtcgccgaccgtatcccc
tatttcgacctgccttccaccaatgacagccgcttctgcaccggcggggaatgccgcgac
gacatctttttcgacaagctcgacgcctggctcgataacgtcaagaaggatagtgtcatc
gtgctgcaccagatgggcagccatggtccgacctactacctgcgttacaccgacgagttc
cgcaagttcacgccggactgccgcaccgccgagcttggcaattgcagcgacgccgaaatc
gtcaactcctacgacaacacgcttctttataccgaccacttcctctcgaccgtgatcgac
aagctgaaggcgcgttccgacaagctggcaacaggcatgatctacgcctcggaccacggc
gagtcgcttggcgaaaacggcgtctacctgcatggcgcgccctatctcctcgcgcccgac
cagcagacccatgtgccgtttctcgtgtggttcgatgacgattttgccaaatccatggga
ctggacaaggcctgccttgcgaaaagcgcggcagagggcgggcgctcgcacgacaattat
ttccacagcatccttggaatgatgaacgtctccacctcggtctacgatccctcgctcgat
gtcttcagcggctgtacccaacgccggacgagctga

DBGET integrated database retrieval system