KEGG   Rhizobium pusense IRBG74: BN877_II1455
Entry
BN877_II1455      CDS       T02867                                 

Definition
(GenBank) Beta-lactamase
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir00311  Penicillin and cephalosporin biosynthesis
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BN877_II1455
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_II1455
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_II1455
Enzymes [BR:rir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     BN877_II1455
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    BN877_II1455
SSDB
Motif
Pfam: Beta-lactamase2 Beta-lactamase Peptidase_S11
Other DBs
NCBI-ProteinID: CDI11244
UniProt: U4Q1U4
LinkDB
Position
linear:1523544..1524392
AA seq 282 aa
MTMTVAAQLNAICDAQPFVTRFMVRNLLTGEEIGRGENEETPSGSTRKTSIMMAVLKAAS
EGRIDLDQPVIYEKRLAEEVASGMFRYMTPGIVISLRDAVAGMMVLSDNVCTKMVLERLT
LEEVDGYCKSLGMSNTHHRFLIPPLALAADHPLKTVTTTSAADQVLLLQTILDAQSSRQA
QAKLGCSAQLCEWAMQTLKNQILRYGIRSRLPFEAVVASKSGRGKRGRMDAGIVYRNGAP
SFIITAYTDEVPQTMPDGTPGYTIALETIGRLAQACWDGFHQ
NT seq 849 nt   +upstreamnt  +downstreamnt
atgacaatgacagtggctgcccaattaaatgcgatctgtgatgcacagcctttcgtgacg
cgcttcatggtgcgcaatctcctgaccggtgaagagatcggccggggagaaaacgaggag
acgccatcgggcagcacccgcaagacgtcgatcatgatggcagtgctcaaggccgccagc
gaagggcggatcgatctcgaccagcccgtcatctacgaaaagcggctggcggaagaggtg
gcgagcggcatgttccgctacatgaccccgggtatcgtgatttcgctacgcgatgccgtc
gctggcatgatggtgctgagcgataatgtctgcaccaagatggtgctggagaggctgacg
ctggaagaggtggacggctattgcaaatcgctcggcatgtccaacacccatcatcgtttt
ctcattccgccattggcactggcggcggaccatccgcttaaaaccgtcaccacaacgtcg
gcggcggaccaggtgttgctgttgcagaccattctcgatgcccagtcctcgcggcaagcg
caggcgaagctcggatgcagtgcgcaattgtgcgaatgggcgatgcagacgctgaagaac
cagattttgcgttatggaattcgctcccgcctgccgttcgaggccgtggtggcgagcaag
agcggtcgcggcaaacgtggtcgcatggatgcgggcatcgtctacagaaacggcgcgccg
tccttcatcatcacggcctataccgatgaggtgccgcaaaccatgcctgacggcacgccg
ggatacaccatcgcgctcgaaacgatcggccggctggcgcaggcgtgctgggatggcttt
catcaataa

DBGET integrated database retrieval system