KEGG   Rhizobium sp. IRBG74: BN877_II1552Help
Entry
BN877_II1552      CDS       T02867                                 

Gene name
dadB
Definition
(GenBank) Alanine racemase, catabolic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00473  D-Alanine metabolism
rir01100  Metabolic pathways
rir01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN877_II1552 (dadB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BN877_II1552 (dadB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
    BN877_II1552 (dadB)
Enzymes [BR:rir01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BN877_II1552 (dadB)
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Racemase
   BN877_II1552 (dadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDI11338
UniProt: U4Q5J2
LinkDB All DBs
Position
linear:complement(1628681..1629847)
Genome map
AA seq 388 aa AA seqDB search
MDMQISRQQAAGGASGHLTIDLGALRDNYLALAAMAPASQTAAVVKADAYGLGADMVSQT
LFDAGCRHFFVAHIDEALALRLRLPAQARIFVLNGLQPGNETSCAAMAITPVLNSLEQIA
QWAVHAKTLGRKLAAAVQIDTGMCRLGLSPEELETLTSQPQLFDGIDIAFVMSHLACADE
PGHACNAAQLSAMRQATIAFPDVPVCFSNSGGIFLGREYHNHLLRPGIALYGGAPSVDRP
NPMKPVVRLDLAVIQTRTVSAGSLVGYGGSFEASGSTRLATIAAGYADGLPRSLSNRGAA
WHDGVRLPIAGRVSMDSIILDISALPEGTLTQGSFVQMIGPEQTLEDIADDAGTIAYEIL
TGLGRRYRRTYIQPDETPTFASTSVNHK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcagatcagccgccagcaggcagcgggtggtgcaagcggccatctgaccatc
gatctcggcgcattgcgcgacaattatctggcacttgcggcgatggcgcccgcatcccag
acggcggcggtcgtcaaggccgatgcatatggcctcggtgcggatatggtctcgcaaacc
ctgttcgatgcggggtgtcgtcatttcttcgtcgctcatattgacgaggcgctggcgctt
cggctgcgtcttcccgcccaggcgcggatcttcgtcctcaacggccttcaacccggcaat
gagacctcctgcgccgccatggcgatcacaccggttctcaattcgctggagcagatcgcc
caatgggcggtccatgccaagacgctcggcaggaaacttgcagccgccgtgcagatcgat
accggcatgtgccgcctcggcctttcccccgaagagctggaaaccctcacctcccagccg
caactgttcgatggtatcgacatcgccttcgtcatgagccacctcgcctgcgccgacgaa
ccgggccatgcatgcaatgcggcgcagctgtcggcgatgcggcaggccacgattgcgttt
cctgatgtcccggtctgtttttccaactccggaggtatttttctgggtcgtgagtaccac
aaccacctgctgcgccccggcatcgcgctttacggcggcgcaccctctgtcgaccgcccg
aacccgatgaagccggtcgttcgcctcgatctcgccgtgatccagacccgcaccgtttcc
gccggttcgctggttggttacggcggttccttcgaagcgtccggctctacgcgtcttgcg
acgatcgccgccggttatgccgacggcctgccgcgctcgctcagcaatcgcggcgcggca
tggcatgatggcgtgcgcctgccgatcgcggggcgcgtttcgatggacagcatcattctg
gacatatccgccctgcccgagggaacattgacccaaggcagtttcgtgcagatgatcggc
cccgagcaaacgcttgaagacatcgcggacgatgcgggcacgatcgcctacgaaatcctg
accggcctcggccgtcgttatcgccgtacctatattcagccggacgaaaccccgaccttt
gcttcaacatcagtcaatcacaagtga

DBGET integrated database retrieval system