KEGG   Rhizobium pusense IRBG74: BN877_II1639
Entry
BN877_II1639      CDS       T02867                                 

Definition
(GenBank) DNA segregation ATPase, FtsK/SpoIIIE family
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_II1639
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_II1639
SSDB
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_gamma AAA_10 DUF87 T2SSE AAA_22 TrwB_AAD_bind AAA_19 DEAD ResIII
Other DBs
NCBI-ProteinID: CDI11425
UniProt: U4Q286
LinkDB
Position
linear:1723163..1725862
AA seq 899 aa
MMSVHAAMSFSRSRFQNSSNSVGEGSENARHAGVQTAAWQRTIVTAAGAAPRQNADVIAA
DAIEGRAEMPGWQNAFVLGPNVRFTRTPESAFNRRMPVETPNIPEEEAPAASVPAAAEPE
TAVRQDAPAPQPAAKPAEQRIAPPRMPFLPQPPDARGARALTYKLRLELARKQAEEAAAA
VRGPSSSTSAAPDAEPAAPQAFEPQPAAQPEAETQTSIPAFAAHLPDELFWEVMTLDLPG
DAADAVPTQVRSAFSVSAPAAPAPVNTVLTAPPSAVAVAPVSPAAAPVVLSAEPPVVTVP
GGSAIRLYREIGVRQAFIPAAGVAPEQEFTSQPIADAAMAVAPQQLAEQIQPVERIVAEP
RFTPRAPIQSSQPMFREAPVFADGEYEYPSIDLLQEARVQQTTTMTPEALEQSAGLLESV
LEDFGIKGEIIDVRPGPVVTLYEFEPAPGVKSSRVIGLSDDIARSMSALSARVAVVPGRN
VIGIELPNPVRETVYLRELIEAQDYAETRQKLALCLGKTIGGEPVIAELAKMPHLLVAGT
TGSGKSVAINTMILSLLYRLKPEECRLIMVDPKMLELSVYDGIPHLLTPVVTDPKKAVMA
LKWAVREMEDRYRKMSRLGVRNIDGYNARAAAARAKGETVFCNVQTGFDRATGEAVYEQE
EMDLTAMPYIVVIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITG
TIKANFPTRISFQVTSKIDSRTILGEQGAEHLLGQGDMLHMMGGGRIARVHGPFVSDEEV
EKVVAHLKTQGRPEYLGTVTEDAEEAEEEAEEDTAVFDKTSMGDDDSDDLYEKAVKIVMR
DKKCSTSYIQRRLSVGYNRAASLVERMEQEGIVGPANHVGKRAIIAGERDSYDAMGSDD
NT seq 2700 nt   +upstreamnt  +downstreamnt
atgatgagtgtgcacgctgccatgagcttctcccgatccagatttcagaattcgtccaat
agcgtaggggaggggagcgaaaacgcccgtcatgccggcgtccagacggccgcgtggcag
cggacgatcgtgacggctgcaggtgcagcgccgcggcagaatgctgacgtgatagcagcc
gatgccatcgaaggccgcgccgagatgcccggctggcagaatgctttcgtgcttggcccg
aatgtccgctttacccgcacaccggaaagcgcctttaaccggcgtatgccggtggagacg
ccgaatatcccggaagaggaggcgcccgctgcctccgtaccggctgccgcagagcccgag
acagcagttcgccaggatgcgccggcaccccagcccgccgcgaagccggccgagcaacgc
atagcaccgccgcgcatgccgtttctgccgcagccgcccgacgcccgcggtgctcgcgcc
ctgacttacaaattgcggctggagcttgcccgtaaacaggcggaagaggctgccgcagcc
gtgcgggggccatcttcatcgacgtctgccgcgcccgatgcggaacccgcagcgccgcag
gcgtttgagccgcaacctgccgcgcagccggaagctgagacgcagacttccattcccgcc
tttgccgcccatctgccggatgagctgttctgggaagtgatgacgcttgatctgcccggc
gatgcggctgacgctgttcccacacaggtacggagcgcattttccgtttcggcgcccgca
gctccggcgcctgtaaacaccgttctgacagcgcctccatccgcagtggctgtcgctccc
gtctcgcccgcagccgccccggttgtcctttcggccgagccaccggttgtcaccgtaccc
ggcggctccgccatccggctctatcgggaaattggcgtgcgtcaggcattcattccagcc
gccggcgtggctcccgaacaggagttcacgtcgcagccgatagcggacgctgccatggcc
gtagcgccgcagcagcttgcagagcagattcagccggtggaaaggatcgttgccgagccg
cgttttacgccgcgagcgcctatccagtcttctcagcccatgttccgtgaagcacctgtc
ttcgccgatggggaatatgagtatccttcgattgacctcctgcaggaagcccgcgtccag
cagaccacgaccatgacaccggaagccctggaacagagcgccggtctactcgaaagcgtg
ctggaggatttcggcatcaagggcgagatcatcgatgtccgtcctggtcctgtcgtcacg
ctctatgaattcgagcccgcccctggcgtcaagtcctcgcgtgtcatcggtctctctgac
gatatcgcgcgctccatgtcggcgctctcggctcgcgttgcggtcgtgcccggccgcaat
gtcatcggcatcgagctgccgaacccggtgcgcgagacggtttacctgcgcgaactgatc
gaggcgcaggattacgccgagacacgccagaagcttgccctttgcctcggcaagaccatc
ggcggcgaaccggttatcgccgaacttgcgaagatgccgcaccttctggtcgccggtacg
accggttcgggcaagtccgttgccatcaacaccatgatcctgtcgctgctctaccgcctg
aagccggaagaatgccgcctgatcatggtcgacccgaagatgctcgagctctcggtctat
gacggtattccgcatctcctgacgcctgtcgtcaccgatccgaaaaaggcggtgatggcg
ttgaagtgggcggtgcgcgaaatggaagaccgctaccgcaagatgtcgcgtctcggcgtg
cgcaatattgatggttacaatgcaagggccgctgctgcccgtgccaagggcgagacggtg
ttctgcaatgtccagaccggctttgatcgcgccactggcgaagcggtctatgagcaggag
gaaatggacctgacggcgatgccttatatcgttgtcatcgtcgatgaaatggccgacctg
atgatggtcgccggcaaggagatcgaaggtgcgatccagcgtctggcgcagatggcgcgc
gccgccggcatccatctcatcatggcgacccagcgtccctcggtcgatgtcatcacgggc
acgatcaaggccaatttcccgacgcgcatctccttccaggtgacgtcgaagatcgacagc
cgcaccattcttggtgagcagggggcggagcatctgctcggccagggcgacatgctgcac
atgatgggtggtggccgcatcgcccgtgttcacggccccttcgtgtccgacgaggaagtt
gaaaaggtcgtggcgcatctgaagacgcagggtcgtccggaatatctgggcacggtcacg
gaagatgccgaggaagcggaagaagaggcggaagaggatacggccgtcttcgacaagacc
tcgatgggcgacgacgacagcgatgacctctatgaaaaggccgtcaaaatcgtgatgcgc
gacaagaagtgctcgacctcctatatccagcgccgcctttcggtgggctataaccgcgcc
gcctcgctggtggagcgaatggagcaggaaggcattgtcggacctgccaaccatgtcggc
aagcgcgccatcatcgccggcgagcgcgactcttacgacgcgatgggctccgacgactga

DBGET integrated database retrieval system