KEGG   Rhizobium pusense IRBG74: BN877_II1768
Entry
BN877_II1768      CDS       T02867                                 

Gene name
ftsZ1
Definition
(GenBank) GTP-binding tubulin-like cell division protein
  KO
K03531  cell division protein FtsZ
Organism
rir  Rhizobium pusense IRBG74
Brite
KEGG Orthology (KO) [BR:rir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_II1768 (ftsZ1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rir04812]
    BN877_II1768 (ftsZ1)
   02048 Prokaryotic defense system [BR:rir02048]
    BN877_II1768 (ftsZ1)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_II1768 (ftsZ1)
Cytoskeleton proteins [BR:rir04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   BN877_II1768 (ftsZ1)
Prokaryotic defense system [BR:rir02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BN877_II1768 (ftsZ1)
SSDB
Motif
Pfam: Tubulin FtsZ_C
Other DBs
NCBI-ProteinID: CDI11553
UniProt: A0A1L9D1B6
LinkDB
Position
linear:1870866..1871828
AA seq 320 aa
MTQSPRATIARNTPNIAVVGVGGGGGNAINNMIAEGIGGVDFIAANTDAQALKKTNAPRL
VQLSSELTGGLGAGADPEVGRQAAIDSLDEIMDHLSGYDMCFITAGMGGGTGTGAAPVIA
EACRAKNILTVGVVTLPFSFEGVRRMRAAEYGFANLLNTADTVIVIPNQNLLRIADAGTT
FENALKTADKVLSLGVRCITDLILREGLVNLDFADVRYVMKNGGRALMGTAQAKGEKRAS
EAAAAAIANPLLGEPSLKEARGALVSISGGNDLTLYEIDEAMTLVREAVSEETDVVMGAS
FDPTLDGAFKISVVATGLRN
NT seq 963 nt   +upstreamnt  +downstreamnt
atgacacagtctccgcgcgccaccattgcccgcaacactcccaacatcgccgtcgtcgga
gttggtggcggtggcggaaacgcgatcaacaacatgattgccgagggtatcggcggcgtc
gatttcatcgcggccaatacggatgcgcaggcgctgaagaagaccaatgcgccacggctc
gtgcagctcagctcagaactgacgggcgggcttggagcgggtgctgatcccgaggttggc
cgacaggctgcgatcgattccctcgatgagatcatggatcacctgagcggctatgatatg
tgtttcatcaccgccggcatgggcggcggcaccgggacgggtgcggcacccgttattgcc
gaagcctgccgtgcaaagaacattctcacagttggtgtcgtcacgcttcctttcagcttt
gagggcgtgcgccgcatgcgggctgctgagtacggtttcgccaatctgctcaacacggcc
gataccgtcatcgtcattcccaaccagaacctgctgcgcattgccgatgccggcaccacc
ttcgaaaatgcgctcaaaaccgccgacaaggtgctgtcgctcggcgtgcgctgcatcacc
gatctcattttgcgtgaaggtctggtcaatctcgatttcgccgatgtgcgatacgtcatg
aagaatggcggccgggcgctcatgggcaccgcacaggccaagggcgaaaagcgtgcttcg
gaagcagcggcagcggccattgccaatccgctgctcggcgagccctcgctgaaggaagca
cgtggcgcgctggtctccatttccggcggcaacgacctgacgctttacgagattgatgaa
gcgatgacgctggtacgtgaggctgtcagcgaggaaaccgatgtggtgatgggcgcttcg
ttcgacccaacgctggacggcgctttcaagatttccgtcgtggccaccggcctgcggaac
tga

DBGET integrated database retrieval system