KEGG   Rhizobium pusense IRBG74: BN877_p0444
Entry
BN877_p0444       CDS       T02867                                 

Gene name
ifeR
Definition
(GenBank) Isoflavonoid efflux regulatory protein
  KO
K18135  TetR/AcrR family transcriptional regulator, repressor of the mexAB-oprM multidrug resistance operon
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_p0444 (ifeR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rir03000]
    BN877_p0444 (ifeR)
Transcription factors [BR:rir03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    BN877_p0444 (ifeR)
SSDB
Motif
Pfam: TetR_N TetR_C_6 TetR_C_2 HTH_Tnp_1_2 TetR_C_20 Sigma70_r4 UPF0122
Other DBs
NCBI-ProteinID: CDI12166
UniProt: U4QID5
LinkDB
Position
IRBL74_p:complement(366766..367497)
AA seq 243 aa
MHCRPVVISCGGTGFAFAGLVHVESNGEIQTWEFRDVRRTKEQAAETGRQILQAAETLFL
DKGYDNVSLEEIAALSGVTRGAIHWHFKNKHGLLLALRNEAQEPFRRFADELSEGRSSAS
IEKLGDIIADTFRLLEKDPRQRGLLRVMMRLDIVLAEKDEAAQNTFPEEMHELFVRIFRA
VERNPGMVKPWTPEKAASMLYAAMGGLITEWALSKSVFTLSEDGSLLVATLLAGVQQKHQ
GLN
NT seq 732 nt   +upstreamnt  +downstreamnt
atgcattgccgtcccgtcgtgataagttgcggcgggacggggtttgcttttgccgggctg
gtccatgtagaaagcaacggcgaaattcagacatgggagtttagagacgtgaggagaacc
aaggagcaggcggcggaaaccggtcgccagatcttgcaggcggcagagaccctgtttctg
gacaagggctatgacaatgtcagcctagaagaaatcgctgctctttccggtgtgactcgg
ggtgcaatccattggcatttcaagaacaagcacgggcttctgctcgctctccgaaacgag
gcgcaggaaccgtttcggcgatttgccgacgaactttccgaaggccgcagctccgcttcc
atcgaaaaacttggcgacatcatagccgacaccttcaggctgctggagaaggatccgcgt
caacgcggtctgctgcgggtgatgatgcggctcgatatcgttctggcggaaaaggatgag
gccgcacaaaacacgtttcccgaggaaatgcatgaattattcgtgcgcatattcagggca
gtcgaacgaaaccccggaatggtgaaaccgtggacgccggaaaaggctgcctccatgctt
tatgcggccatgggcggtctaattacggaatgggcgctgagcaagagcgtctttacactt
tccgaagacgggagccttctggtcgcgactttgctcgccggagttcagcaaaaacaccaa
ggcctcaactga

DBGET integrated database retrieval system