KEGG   Rhizobium pusense IRBG74: BN877_p0446
Entry
BN877_p0446       CDS       T02867                                 

Gene name
ifeA
Definition
(GenBank) isoflavonoid efflux membrane-fusion protein
  KO
K03585  membrane fusion protein, multidrug efflux system
Organism
rir  Rhizobium pusense IRBG74
Pathway
rir01501  beta-Lactam resistance
rir01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BN877_p0446 (ifeA)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BN877_p0446 (ifeA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rir03036]
    BN877_p0446 (ifeA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rir02000]
    BN877_p0446 (ifeA)
   01504 Antimicrobial resistance genes [BR:rir01504]
    BN877_p0446 (ifeA)
Chromosome and associated proteins [BR:rir03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BN877_p0446 (ifeA)
Transporters [BR:rir02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   BN877_p0446 (ifeA)
Antimicrobial resistance genes [BR:rir01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MexAB-OprM [MD:M00718]
    BN877_p0446 (ifeA)
SSDB
Motif
Pfam: HlyD_D23 HlyD HlyD_3 Biotin_lipoyl_2 OEP Biotin_lipoyl
Other DBs
NCBI-ProteinID: CDI12168
UniProt: U4Q4I9
LinkDB
Position
IRBL74_p:complement(370647..371801)
AA seq 384 aa
MVEKSQWRRGQTVALALILSCVLYPGRVLSQQQPTPSVTVETAKAADFTLTARLPGRIKP
STISEVRPQVSGIIRERLFEEGARVEAGQVLYKIEDETYVAAVESAKANVAQAQASYDFA
VVDARRAEETFANNVSSASNRDNKIAERNKTQAALQVARAQLTTAQIDLERTTIRAPISG
IIGFSETTAGALVAAQQTTALTTIRALDTIYVDVTQSVNDLLRWNADKRVGGSQSLSVAT
MILPNGQTYPIKGDLKAAEPRVEPTTGMVTLRISFSNPDNRLLPGLYVEVELPQAVTKDA
ILVPQSAVMRNTKGEASVWIVEGGKIVPRPVTIVTGAGNRWVTSSGLKPGDQIVMSGFQK
VAPGASVEIEQQPVAQQAARVGSN
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggtcgagaaaagtcagtggcggcgcgggcaaacggtggcccttgcgttgatcctatcc
tgtgtcctctatcccggaagagtgctctcgcagcaacaacccaccccgtcggtcacggtt
gaaaccgccaaagcggcggatttcacgctgactgcgcgtttgcccggacgtatcaaacct
tcgacgatttcagaggtacggccgcaggtctcaggcatcatccgggaacgattatttgaa
gaaggcgcccgtgtcgaggccggtcaggttctctacaagatcgaggatgaaacctatgtc
gcggcggtggaatccgcaaaggccaacgtcgcccaggcgcaggccagctacgatttcgcc
gtcgtcgatgcgcgccgtgctgaggagacatttgccaataatgtcagctcggcgtcgaac
cgcgataacaagattgcagagagaaacaagacgcaggccgcacttcaggtggcgcgggct
cagctgacgacagcacagatcgacctcgagagaacgacgatccgcgcgccaatctccggc
atcatcgggttttcggaaacgactgccggcgcgcttgtggctgcgcagcagacgacggct
ttgaccacgatccgtgcgctcgacacgatctatgtcgacgtaacccagtccgtaaacgat
ctgttacgctggaatgccgacaaaagggtagggggcagccagtccctgtccgtcgcaacg
atgatccttcccaatggccagacctacccgatcaagggcgacctgaaggcggccgaaccg
agggtcgagccgacgacaggcatggtcacccttcgaatttcattttccaacccggataac
aggcttctaccgggcctctatgtcgaggttgaactgccgcaggccgtcaccaaggacgcg
atcctcgttccgcaaagcgccgtgatgcgcaataccaaaggcgaggcttccgtctggatc
gtggaaggcggcaagattgttcctcgtccggtaaccatcgtcactggtgccggcaatcgc
tgggtcaccagcagcggcctgaaaccgggggaccagatcgtcatgtccggtttccagaag
gtggcacccggtgcttcggtggaaatagagcaacagccggtggcccagcaggctgcccgg
gtcgggagtaactga

DBGET integrated database retrieval system