KEGG   Rivularia sp. PCC 7116: Riv7116_1977Help
Entry
Riv7116_1977      CDS       T02364                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00620  Pyruvate metabolism
riv00680  Methane metabolism
riv00710  Carbon fixation in photosynthetic organisms
riv01100  Metabolic pathways
riv01120  Microbial metabolism in diverse environments
riv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:riv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Riv7116_1977
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Riv7116_1977
   00680 Methane metabolism
    Riv7116_1977
Enzymes [BR:riv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Riv7116_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFY54516
UniProt: K9RAQ8
LinkDB All DBs
Position
2444500..2447559
Genome map
AA seq 1019 aa AA seqDB search
MSTVLYTDAQAVNIYPASDLFLRHRLQIVEEVWELVLREECGQQMVDLLRQLRDLCSPEG
QATDNQASSVSSLIENLSINEAIRAARGFALYFQLINIVEQDYEQKQQLTRYEEEERSGE
KETLPPIIYSSNQQVEDVHLNSGVNADLLVKSWQAKPNSKDKGTFAELFPKLFKLNVPPA
QIQRLIAQLDVRLVFTAHPTEIVRPTIREKQRRVVDLLQNLDASEKRSGNTSAGVYSWET
TQLRSQLLEEIRLWWRTDELHQFKPSVLDEVDYALHYFQEVLFEAIPQLYQRLEYSLNST
FSRLEPPSKSFCQFGSWVGSDRDGNPSVTPEITWQTACYQRHMVLNKYIDSAKGLIELLS
VSLHWSDVLPDLLESLEIEQSQMSEVYDELALRYRQEPYRLKLAYVVKRLENTRERNSAL
RKREIIKDDKAPIYRSVSEFLADLRLIQRNLSETGLKCQQLENLLTQVEIFGFNLTQLDI
RQESTRHSDAIGEILEYLGILDQKYDDLPEEEKIAWLTKELQTRRPLIPAQLPFGDKTNE
IVETMRLVHSLQKEFGCNICQTYIISMCRSVSDVLEVLLLAKEAGLYDPGTAVGTIRVIP
LFETVEDLQRSRQVMKDLFSLPLYRALLAGGYEVYEEGKETKQEGESSPLYPNLQEIMLG
YSDSNKDSGFLSSNWEIHKAQKSLQHIAEQYGLGVRIFHGRGGSVGRGGGPAYEAILAQP
GKSINGRIKITEQGEVLASKYSLPDLALYNLETITTAVIQASLLRAGFDDIEPWNEIMEE
LAARSRSHYRDLIYEQPDFIDFFNQVTPIEEISQLQISSRPARRPSGKKGLSSLRAIPWV
FSWTQTRFLLPAWYGVGTALQEFLNEAPEDHIQLLQCFYRKWPFFKMVISKVEMTLAKVD
LQMGRHYVEELSKDEDKQRFDRVFNQISSEYYLTRNLVLKITGHERLLDGDPVLQRSVQL
RNGTIVPLGFIQVSLLKRLRDSKNNASSGVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgttttatacactgacgctcaggcagtaaatatctaccccgcatcagatttg
tttttgcgccatcgcctgcaaatcgtagaggaagtgtgggaattagttctccgtgaagaa
tgcggacaacaaatggtagatctcctcagacaactacgcgatttatgctctccagaagga
caagcaactgataaccaagcttcttcggtatcaagcttaattgaaaatttgagcattaat
gaagcaattagagcggctcgtggatttgctttgtattttcaattaataaatatcgtagaa
caggattacgaacaaaaacagcagctaactcgctacgaagaagaagagcgatctggagag
aaagaaactttaccgcctattatttattcgagcaatcaacaggttgaagatgttcatctc
aacagcggcgttaatgcagatttactagtcaaaagttggcaagccaaaccaaattcaaaa
gacaaagggacatttgccgaactatttcccaaattattcaagttaaacgtacctccggca
cagattcaacggttaattgcacaattggatgtgcgtttggtgtttacggctcaccccact
gaaattgtccgtcccaccatccgagaaaaacagcgacgagttgtagatttactacaaaat
ctggatgcatccgaaaaacgttctggtaatactagcgccggagtttattcttgggaaaca
acccaactccgctctcaattgcttgaagagatacgtttgtggtggcgtaccgatgaacta
catcaatttaaaccaagcgtacttgatgaagtagactacgcgctgcattacttccaagaa
gttttatttgaagcaattcctcagctttaccagcgtctggagtactcattaaattcgact
ttttcgagacttgagccacctagtaaaagcttttgccagtttggttcttgggtaggttcc
gatagagatggaaatccttccgtaacaccggaaattacttggcagactgcttgctatcaa
cgccatatggtgttaaacaaatacattgattctgctaagggtttaattgaattactcagc
gtatcgctacactggagcgacgtactacctgacttattagaatctctggaaattgaacag
tcccagatgagcgaagtttatgatgaattagcattacgctatcgtcaagaaccttatcgt
ttaaagctcgcttatgtcgtaaaaagactagaaaacacgcgggaacgtaattcagcattg
cggaagcgggaaatcattaaagacgataaagctccaatttaccgttctgtttcagaattt
ttagccgatttgaggttaattcaacgcaacttgtcagaaacgggtttaaagtgtcagcaa
ttggaaaatctcctgacacaagttgaaatttttggctttaatttgacccaattagatatt
aggcaagaatcaactcgtcacagcgatgcaatcggcgaaattctcgaatatctaggaatt
ttagaccaaaagtacgatgacttaccagaagaagaaaaaattgcttggttaactaaagaa
ctgcaaacaagaagacctctaattcccgctcagctaccgtttggggataaaaccaacgaa
atcgtggagacgatgcgcttagtgcattcgttgcaaaaagaatttggttgcaacatttgc
caaacttacattatcagtatgtgtcgttccgtcagcgatgtgctggaagtattgttatta
gctaaagaagcaggactttatgaccccggaacggctgtaggtacaatccgagtcataccc
ttatttgaaacagtagaagatttacagcgttcgagacaagtaatgaaagacttgttttct
cttcctttatatcgcgctttacttgccggaggatatgaagtttacgaggaaggcaaggaa
acaaagcaagaaggcgaaagttctcctttatatcccaacttacaggaaatcatgttgggg
tattctgacagtaataaagactctggcttcctcagcagtaactgggagattcacaaagcc
caaaaatctttgcagcatatagcagaacaatacggcttgggcgtgcgaatattccacgga
cggggtggttccgtaggacgcggcggcggaccagcttatgaggcaattttggcgcaaccg
ggcaaaagtattaacggtcggataaaaattaccgaacaaggtgaagttttagcttctaaa
tattccctaccggatttagcactatacaatctcgaaacaattaccactgccgtaattcaa
gccagtttattgcgtgccgggtttgacgatatcgaaccttggaacgaaatcatggaagaa
ttagcagcgcgatcgcgttctcattatcgagatttaatctacgaacaaccggattttatt
gactttttcaatcaagttacccccatagaagaaattagtcagttacaaattagttctcgt
ccggctcgtcgtccgtcgggtaagaaaggcttgagcagtttgcgtgcaattccctgggta
tttagctggacgcaaactagatttttgctacctgcttggtatggagtaggtacggcgttg
caagagtttcttaatgaagctccagaagaccacattcaattattgcaatgcttttacaga
aaatggccgtttttcaaaatggttatttctaaggtagaaatgaccttggctaaagtcgat
ttacaaatgggacggcattatgtagaagagctatctaaagatgaagataagcagcgtttc
gatcgagtattcaaccagatttctagcgagtactatctgacgagaaatttagtgctgaaa
atcaccgggcacgaaagactcttggatggagatccagttttacaacgttccgtacaatta
agaaatggtactattgtacctttagggtttatccaagtatctttactcaagcgtttacgt
gatagtaaaaacaatgcgagttctggagtcattcactcgcgctacagtaaaggagaattg
ctccgaggggcgcttttaactattaacggaatcgctgcgggcatgagaaatactggttga

DBGET integrated database retrieval system