KEGG   Rivularia sp. PCC 7116: Riv7116_2009Help
Entry
Riv7116_2009      CDS       T02364                                 

Definition
(GenBank) exonuclease SbcC
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
riv  Rivularia sp. PCC 7116
Brite
KEGG Orthology (KO) [BR:riv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:riv03400]
    Riv7116_2009
DNA repair and recombination proteins [BR:riv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Riv7116_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SMC_N SbcCD_C Rad50_zn_hook AAA_29 AAA_21 HALZ RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFY54546
UniProt: K9RAT3
LinkDB All DBs
Position
complement(2484127..2487153)
Genome map
AA seq 1008 aa AA seqDB search
MIPVQVTLKNFLSYQDASLDFSGLHTACICGSNGAGKSSLLEAITWVVWGESRAASEDDI
IHTGAKDVRVDFTFEANGEIYRVIRTRRRGSSSALEFQIETQEGFKSLTSKGLRATQEVI
LSHIKLDYDTFINSAYLRQGRADEFMLKRPSERKEILAELLKLNQYDELEDKAKELSRQL
KARGEELERTLGSIKTQLQQQETIAQQKTELETELNELQKLQGFDNIQLQNLQVIQHQRQ
GWEEQLHFVRQQYNNLTQDSKRLESEQSSLKAQLDSLKGLLNREAEIKAGYAHYQTLQSE
EESMGALFAQYTRASQLRQQKLSQLSKHIQGIERQLQQSQAQLEALQQQEKDIERTLKHT
GDVETALEKLKAARGHLSHLDNLQMQVSPLLQQRSLLQTELHRTQAGIVARVEQLETTHR
QLQNQSRRQPQIQQAVMEVETKIEQLDKDKVYLQRLQEKGLEKRSFMERLHAQQREYERL
LGELEQKLQMLQNPDAICPLCERPLDEHHWNRVVDKTEVEYNDTQGQLWVFREQLAVSER
EIQLFRQEYRSVNSKLSPYESLREQKGELAAQLQATSEVDQQIQQITDEKERLEVTLRLG
DYAPQKQKELQELEEYLQQLDYNEQNHALARSEVEKWRWAEIKQGQIKDARKRQAQLAAR
KPEIQTTINQLEHQIELEQVDSEIARAIKELENQITHMGYDNERHNQIRIDVRQAQSWHL
LHQQLVSALSQYPEIKKRSQHVEEALKARLSEKQQLATNINGIIAQLEQTTNPTAQIQDL
EQKLANRRRQLDDKLGHLGRLQQQSQYLENLQIQHTEKQQQLKTVRSQQRVYQELAQAFG
KNGIQALMIENVLPQLEAETNQLLSRLSANQLHVQFVTQRAGKTSKAKKKNAKLIDTLDI
LIADARGTRAYETYSGGEAFRINFAIRLALAKLLAQRAGAALQLLIVDEGFGTQDNEGCD
RLIAAINAIAPDFACILTVTHMPHLKEAFAARIEVNKTQDGSKIRMMI
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgattccggtacaagtaacattaaaaaactttcttagttatcaagatgcaagtttagat
tttagcggattgcatacggcgtgtatttgtggttctaatggagctggcaagtcttcgctt
ttagaggctatcacctgggtagtatggggtgaaagcagagccgcttcagaggacgatatt
atccacactggagccaaagatgtccgagtcgattttacttttgaagcaaacggagaaatt
tatagagtaattcggactcgccgtcggggttctagtagcgctttagagtttcaaattgag
acacaagaggggtttaagtccctgacaagtaaaggtttaagggcgactcaagaggtaatc
cttagtcatattaagctagattacgatacttttattaattctgcttacttgcgtcagggg
cgagctgatgagttcatgctcaagcgtccaagcgagcgtaaagagattttagccgagtta
ttaaagttaaatcaatacgatgagcttgaagacaaagccaaagagttatcccgtcagtta
aaagcgcgaggagaagaattagagcgtactctaggctcgatcaaaactcaactccaacag
caagaaactattgctcaacaaaaaaccgaattagaaactgaactcaacgaactacaaaag
ttacagggttttgataatatccagttgcaaaatttgcaggttatccaacatcagcgacaa
ggttgggaagaacagttacattttgttcgccagcaatataacaatctcactcaagatagc
aagcgtctggaaagcgagcaatctagtttgaaagctcaacttgattctttaaaaggatta
ttaaatcgagaagcagaaatcaaagccggatatgcccattatcaaactctgcaatctgag
gaagaatcaatgggggctttgtttgcacaatatacccgtgcttctcaattacgccagcaa
aaactttctcagctgagcaagcatattcaaggaattgagcggcagttgcagcaatctcaa
gcacaattagaagcgctacagcaacaggaaaaagatatcgagcggactctcaagcatact
ggtgacgtagaaacagcgctagaaaaattgaaagcggctcgcgggcatttaagccattta
gataatttgcaaatgcaggtttctcctttgttgcagcagcgctccttattgcaaaccgag
ctacatcgcactcaagcagggatagtagcccgagttgaacagctagagactacacataga
caactgcaaaaccaatctcgcaggcaaccgcaaatccagcaagcggttatggaagtagaa
acgaagattgaacagttagataaagataaggtttatctgcaaagactacaggaaaaagga
ctggaaaaacggagttttatggagcgtttgcacgctcagcagcgcgaatacgaacggctc
ttaggtgagttagaacaaaaattgcaaatgttgcaaaaccccgatgcgatttgtccttta
tgcgagcgtcctttagatgagcatcactggaatcgagtagtggataaaactgaggttgaa
tacaacgatactcaggggcaattatgggtatttcgcgaacagctagcagtctcagagcga
gaaattcagctatttaggcaggaatatcgcagtgttaacagtaaattatctccctatgaa
tctttacgcgagcaaaaaggagaattagccgcacaactgcaagcaactagtgaagttgac
caacagatacagcaaattactgatgaaaaagaaagattagaagtaactttgcgcctaggt
gattatgccccccaaaagcaaaaagaattgcaggagttagaagagtatttacaacagctt
gattacaacgaacagaatcatgctttagctcgtagcgaagttgaaaaatggcgatgggca
gaaattaaacaaggacaaattaaagatgcacgcaagcgacaagcgcagttagcagcgaga
aaaccggaaattcaaacaactattaatcaattagaacatcaaatcgaattagagcaagtt
gattccgaaattgccagagctatcaaagaattagagaatcaaattactcatatgggttac
gataacgaacgtcataaccaaattcgcatagatgtaagacaagctcaatcttggcatttg
ctgcatcagcaattagtttcagccctttcccaatatcccgaaatcaaaaagcgatcgcaa
catgtagaggaagctttaaaagctaggttgagcgaaaaacagcagttagcgacaaatatt
aacggtattattgctcagcttgaacaaaccaccaaccccactgctcaaattcaagattta
gaacagaaattagctaaccgtcgtcgtcaactcgacgataaactcggtcatttaggacgt
ttacagcagcagtctcaatatttagaaaatttgcaaattcagcataccgaaaagcaacag
caactcaaaacagtgcgatcccagcagcgggtttatcaggaattagcccaggcatttggt
aaaaatggtatccaagcattaatgattgaaaacgtcttgccacagcttgaagccgagaca
aatcaattactttcccgactaagtgccaatcaattacacgtacaattcgttacacaaagg
gcgggtaaaaccagtaaagccaaaaagaaaaatgccaaattaatagacaccttagatatt
ttaatcgccgatgctagaggcacccgagcctacgaaacctattctggtggagaagctttt
agaattaactttgcaattcgtttagcattagccaaattactagcgcagcgagccggagca
gcattgcaattactgatagttgatgaaggattcggtactcaagataatgaaggatgcgac
agattaatcgcagcaatcaatgccatagctcccgactttgcctgcattctcacagtaact
catatgccccacctaaaagaagccttcgccgctcgcattgaagtcaataaaactcaagat
ggttctaaaatacggatgatgatttga

DBGET integrated database retrieval system