KEGG   Rivularia sp. PCC 7116: Riv7116_2850Help
Entry
Riv7116_2850      CDS       T02364                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00010  Glycolysis / Gluconeogenesis
riv00020  Citrate cycle (TCA cycle)
riv00620  Pyruvate metabolism
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
riv01120  Microbial metabolism in diverse environments
riv01130  Biosynthesis of antibiotics
riv01200  Carbon metabolism
Module
riv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Riv7116_2850
   00020 Citrate cycle (TCA cycle)
    Riv7116_2850
   00620 Pyruvate metabolism
    Riv7116_2850
Enzymes [BR:riv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Riv7116_2850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase PASTA
Motif
Other DBs
NCBI-ProteinID: AFY55347
UniProt: K9RE62
LinkDB All DBs
Position
3531945..3533264
Genome map
AA seq 439 aa AA seqDB search
MSIHEIFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGYMAHI
LVEAGSSAPVGSAIAFLAETEAEIETAIAQAKSSGAAPEPAKVAAATAPGQTAQSAPTTS
TNGTSQNGAARGSGRKIASPRARKLAKEFKVDLSGISGSGPHGRIIAQDVETAAGKSTTV
KSSAPATAQPTAAPAHSSPKVTPAATPAPMPVAATPGQTVPLTTLQNAVVRTMNHSLSVP
TFHVGYSIATDELNKLYKQIKSKGVTMTALLAKAVAMTLQKHPLLNTNYSEQGIVYPANI
NIAVAVAMDDGGLITPVLQNADRLDIYSLSRNWKSLVERARAKQLQPEEYSSGTFTISNL
GMFGVDTFDAILPPNQGSILAIAASRPEVVATPDGMMGVRTLMKVNITCDHRVIYGAHAA
AFLKDLAQLIETNSQSLTM
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcacgaaatatttatgcccgcgctgagttctacaatgaccgaaggtaaaatc
gtctcttgggagaaatctcctggggacaaagtagagaaaggcgaaacggtggtagttgtt
gaatcagataaagcagatatggatgtggaatccttctatgaagggtacatggcacatatc
ttagtagaagccggaagcagtgcccctgtaggttctgcgatcgcgtttttagcggaaact
gaagctgaaattgaaacagcaatagctcaagccaaatcgagcggtgctgcaccagaaccg
gctaaagttgctgctgcaactgcccccggacaaacagcacaatctgccccaacaacttca
acgaatggtacttctcaaaatggtgcggcacgtgggagtggtagaaaaattgcttcaccc
cgcgctcgtaaattagctaaggaatttaaagttgatttaagcggtatttcgggtagcggt
cctcacgggcgtattattgcacaagacgtggaaactgctgccggtaagtctactacagtt
aaatcttctgcacctgcaacggctcaaccaactgctgcacccgctcacagttctcctaaa
gttacccctgctgcgacacctgcacctatgccagtagcagcaactccagggcaaacagta
cctttgacgactttgcaaaatgccgtagtgcggactatgaatcatagcttgtccgtaccg
acattccacgtaggttattcgattgctaccgacgaattaaacaaactttataagcaaata
aaatctaaaggcgtaacaatgacggcgctactagcgaaagcggtagcaatgacattacag
aaacaccccttgttgaatacaaactattcagaacagggaatagtatatcctgcgaacatc
aatattgcggtagctgtagcaatggatgacggaggattaattacaccagtattgcaaaat
gccgatcgactagatatttacagcttgtcgcgtaactggaaatcattggtagaacgcgct
cgggcaaagcaactgcagccagaagaatacagtagcggcaccttcaccatatccaatttg
ggtatgtttggcgtagatacattcgatgctattttgccacccaatcaaggttcaatatta
gcgatcgctgcatctcgtccggaagtagtagccacccccgacggtatgatgggagtacgt
actctaatgaaagttaacattacctgcgaccatagagttatctacggtgcccatgcagca
gcattcctcaaagatttagcgcaattaattgaaaccaattctcaatctttgacaatgtaa

DBGET integrated database retrieval system