KEGG   Rivularia sp. PCC 7116: Riv7116_2850
Entry
Riv7116_2850      CDS       T02364                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00010  Glycolysis / Gluconeogenesis
riv00020  Citrate cycle (TCA cycle)
riv00620  Pyruvate metabolism
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
riv01120  Microbial metabolism in diverse environments
riv01200  Carbon metabolism
Module
riv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:riv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Riv7116_2850
   00020 Citrate cycle (TCA cycle)
    Riv7116_2850
   00620 Pyruvate metabolism
    Riv7116_2850
Enzymes [BR:riv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Riv7116_2850
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase PASTA MadL
Other DBs
NCBI-ProteinID: AFY55347
UniProt: K9RE62
LinkDB
Position
3531945..3533264
AA seq 439 aa
MSIHEIFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGYMAHI
LVEAGSSAPVGSAIAFLAETEAEIETAIAQAKSSGAAPEPAKVAAATAPGQTAQSAPTTS
TNGTSQNGAARGSGRKIASPRARKLAKEFKVDLSGISGSGPHGRIIAQDVETAAGKSTTV
KSSAPATAQPTAAPAHSSPKVTPAATPAPMPVAATPGQTVPLTTLQNAVVRTMNHSLSVP
TFHVGYSIATDELNKLYKQIKSKGVTMTALLAKAVAMTLQKHPLLNTNYSEQGIVYPANI
NIAVAVAMDDGGLITPVLQNADRLDIYSLSRNWKSLVERARAKQLQPEEYSSGTFTISNL
GMFGVDTFDAILPPNQGSILAIAASRPEVVATPDGMMGVRTLMKVNITCDHRVIYGAHAA
AFLKDLAQLIETNSQSLTM
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgagtattcacgaaatatttatgcccgcgctgagttctacaatgaccgaaggtaaaatc
gtctcttgggagaaatctcctggggacaaagtagagaaaggcgaaacggtggtagttgtt
gaatcagataaagcagatatggatgtggaatccttctatgaagggtacatggcacatatc
ttagtagaagccggaagcagtgcccctgtaggttctgcgatcgcgtttttagcggaaact
gaagctgaaattgaaacagcaatagctcaagccaaatcgagcggtgctgcaccagaaccg
gctaaagttgctgctgcaactgcccccggacaaacagcacaatctgccccaacaacttca
acgaatggtacttctcaaaatggtgcggcacgtgggagtggtagaaaaattgcttcaccc
cgcgctcgtaaattagctaaggaatttaaagttgatttaagcggtatttcgggtagcggt
cctcacgggcgtattattgcacaagacgtggaaactgctgccggtaagtctactacagtt
aaatcttctgcacctgcaacggctcaaccaactgctgcacccgctcacagttctcctaaa
gttacccctgctgcgacacctgcacctatgccagtagcagcaactccagggcaaacagta
cctttgacgactttgcaaaatgccgtagtgcggactatgaatcatagcttgtccgtaccg
acattccacgtaggttattcgattgctaccgacgaattaaacaaactttataagcaaata
aaatctaaaggcgtaacaatgacggcgctactagcgaaagcggtagcaatgacattacag
aaacaccccttgttgaatacaaactattcagaacagggaatagtatatcctgcgaacatc
aatattgcggtagctgtagcaatggatgacggaggattaattacaccagtattgcaaaat
gccgatcgactagatatttacagcttgtcgcgtaactggaaatcattggtagaacgcgct
cgggcaaagcaactgcagccagaagaatacagtagcggcaccttcaccatatccaatttg
ggtatgtttggcgtagatacattcgatgctattttgccacccaatcaaggttcaatatta
gcgatcgctgcatctcgtccggaagtagtagccacccccgacggtatgatgggagtacgt
actctaatgaaagttaacattacctgcgaccatagagttatctacggtgcccatgcagca
gcattcctcaaagatttagcgcaattaattgaaaccaattctcaatctttgacaatgtaa

DBGET integrated database retrieval system