KEGG   Rivularia sp. PCC 7116: Riv7116_3468Help
Entry
Riv7116_3468      CDS       T02364                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00630  Glyoxylate and dicarboxylate metabolism
riv00710  Carbon fixation in photosynthetic organisms
riv01100  Metabolic pathways
riv01120  Microbial metabolism in diverse environments
riv01200  Carbon metabolism
Module
riv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
riv_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
riv_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Riv7116_3468
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Riv7116_3468
Enzymes [BR:riv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Riv7116_3468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFY55923
UniProt: K9REM4
LinkDB All DBs
Position
complement(4304946..4306376)
Genome map
AA seq 476 aa AA seqDB search
MSYSQTRTQSKSGYEAGVKDYRLTYYTPDYTPKDTDLLAAFRMTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVRGEDNQYICYVAYPLDLFEEGSVTNVLTS
IVGNVFGFKALRALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFTFVADAIYKAQAETGEIKGHY
LNVTAPTCEQMLQRAEYAKELGMPIVMHDYLTAGFTANTTLAHWCRDNGLLLHIHRAMHA
VIDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYVEQDKS
RGIYFTQDWASMPGVMAVASGGIHVWHMPALLEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRSLAREGNDIIREACKWSPELAAACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactctcaaacgagaactcagtctaaatcagggtatgaagctggggtaaaagat
tatagattaacttattacacccccgactacactcctaaggatacagaccttttggcggct
ttccggatgactcctcaacccggagtacctccagaagaagctggtgctgctgtggctgct
gaatcttctacaggtacctggacaactgtatggactgacttgcttaccgacctagatcgt
tacaaaggtcgttgctacgacatcgagccagttcgcggtgaagataatcagtacatttgt
tacgtagcttatcctttggatttatttgaagaaggttctgtaaccaacgttttaacctct
atcgtaggtaacgtatttggtttcaaagctctacgtgcgctacgtttggaagatttacgt
atacctgttgcttatctaaagactttccaaggacctcctcacggtatccaggttgagcgc
gacaagttgaacaagtatggtcgtcctctattgggttgtaccattaagcctaagttaggt
ttatccgctaagaactacggacgcgctgtatacgagtgcttgcgcggtggtttggatttc
accaaagatgacgaaaacattaactccgctcctttccaaagatggagagaccgttttact
ttcgttgctgatgctatctacaaagcacaagcagaaaccggcgaaatcaaaggtcactac
ttgaacgtaaccgctccgacttgcgagcaaatgctccaacgggctgagtatgcaaaagag
ttaggaatgcccatcgtaatgcatgactacctgaccgcaggtttcaccgctaacactact
ttggctcactggtgtcgcgacaacggtttgttgctccacatccacagagcaatgcacgca
gtaattgaccgtcaaaagaaccacggtattcacttccgcgtattggctaagtgcttgaga
atgtctggtggtgaccacattcacacaggtactgtggttggtaaattagaaggtgaacgc
ggtatcacaatgggttttgttgacctattgcgtgaaaactacgttgagcaagacaagtct
cgcggtatttactttacacaagattgggcttccatgcccggagtaatggctgttgcttcc
ggtggtatccacgtatggcacatgcccgcactattagaaatattcggtgatgactccgta
ctccagtttggtggtggtactttgggtcacccttggggtaacgctcctggtgcaactgca
aaccgcgttgctttagaagcttgcgttcaagcacgtaacgaaggacgtagcttggctcgt
gaaggtaacgatattattcgcgaagcttgtaagtggtctcctgaattagctgctgcttgc
gaactatggaaagaaattaaattcgagttcgaggcaatggataccgtctaa

DBGET integrated database retrieval system