KEGG   Rivularia sp. PCC 7116: Riv7116_3560Help
Entry
Riv7116_3560      CDS       T02364                                 

Definition
(GenBank) PBS lyase HEAT-like repeat protein
  KO
K02289  phycocyanobilin lyase subunit beta [EC:4.4.1.32]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00196  Photosynthesis - antenna proteins
riv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:riv00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    Riv7116_3560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:riv00194]
    Riv7116_3560
Enzymes [BR:riv01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.32  C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase
     Riv7116_3560
Photosynthesis proteins [BR:riv00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    Riv7116_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEAT_2 HEAT_PBS HEAT Cnd1
Motif
Other DBs
NCBI-ProteinID: AFY56012
UniProt: K9RG02
LinkDB All DBs
Position
complement(4423165..4423785)
Genome map
AA seq 206 aa AA seqDB search
MNTDTPNLIRAVAEADSSARMVSAVQNLVAVKDIAAIPTLIAVFGYNNPAAAVIAVKGLI
ELGDAAVPQLLEQIDDYNYGARAYSIRTLATIGSPQALDLLLEAAATDFAPSVRRAAAKG
LGCLQWQKLDDLERIEAQKKALSTLFSITQDADWAIRYAAVVGLQQLAKIPNLQQEIEAK
FSQMRTEDAAIAVRARVALAQEQVAS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgacaccccaaacttaattcgtgccgtcgcagaagctgattcctcagcgcga
atggtgtcggctgtacagaatttggtagcagttaaagatattgcagcaatacccacatta
attgctgtattcggatacaataatcccgcagcagcagtaatagcagttaagggattaata
gagttaggagatgcagcagtaccgcaacttctagaacaaattgatgattacaactatggt
gcaagagcttattcaattcgtactttagctaccataggtagtccccaagccttagactta
ttattagaagcagctgcaacagactttgctcctagcgtgcgtcgcgcagcagcgaaaggg
ctaggctgcttgcaatggcaaaaacttgatgatttagaacggattgaggctcaaaaaaaa
gcactttcaacattgttctcaattactcaagatgcagactgggcaattaggtatgctgct
gttgtcggcttacagcaattagcgaaaattcctaatttacagcaggagatagaagctaag
ttttctcaaatgcgtacagaagatgctgcaatagccgttcgtgcccgcgtagccttagct
caagagcaagttgctagttaa

DBGET integrated database retrieval system