KEGG   Rivularia sp. PCC 7116: Riv7116_3634Help
Entry
Riv7116_3634      CDS       T02364                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
riv  Rivularia sp. PCC 7116
Brite
Enzymes [BR:riv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Riv7116_3634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFY56084
UniProt: K9RFH8
LinkDB All DBs
Position
complement(4528198..4528797)
Genome map
AA seq 199 aa AA seqDB search
MAYELPPLPYEYTALEPAISKSTLEFHHDKHHAAYVKKYNDAVSGTEFDKKSIEEVIKEI
AGNSEKQGLFNNAAQAWNHTFYWQCMKPNGGGTPAGTLAKKIDADFGSFDKFVEAFKTAG
ATQFGSGWAWLVLDNDTLKVTKTLNADNPLTSGQIPLLTMDVWEHAYYLDYQNKRPAYIE
DFLGKLVNWDFVAQNMAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaattaccacctttaccctatgaatacactgctttagaacctgctatttct
aaaagtaccttagagtttcatcatgacaaacatcatgctgcttatgttaagaagtacaat
gatgcagtttcaggtacagaatttgataaaaagtcaattgaagaagtaatcaaggagata
gctggaaattccgaaaagcagggactttttaacaacgctgcacaagcttggaatcatact
ttttattggcaatgcatgaaacccaatggtggtggtactcctgctggaacattagctaaa
aaaatcgatgctgatttcggtagctttgataaatttgtcgaagctttcaaaactgccggt
gcgactcaatttggtagcggttgggcttggttggtgctagataatgatactttaaaagtc
accaaaaccttgaatgctgataatcctttaactagcggacaaattcccttattaactatg
gatgtatgggaacatgcttattatttggattatcaaaataaacgccccgcttatatcgaa
gattttttaggtaagctagttaattgggactttgttgctcaaaatatggcagcagcataa

DBGET integrated database retrieval system