KEGG   Rivularia sp. PCC 7116: Riv7116_6173Help
Entry
Riv7116_6173      CDS       T02364                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
Organism
riv  Rivularia sp. PCC 7116
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding PP-binding
Motif
Other DBs
NCBI-ProteinID: AFY58527
UniProt: K9RN49
LinkDB All DBs
Position
complement(7816928..7819129)
Genome map
AA seq 733 aa AA seqDB search
MHLNGRKMTQFLNVFPDSTLVDILQYRATHQPDNCAFIFLQDGETQAVNLTYKELDRQAR
AIAFHLQSVNAVGSRALLLYPPGLEFIAAFLGCLYAKVIAVPAYPPRRNQKINRLQAIVK
DAEATLCLTTASELDNIRNKFIQDPQLAGLQYLATDSLIENNLIDWHKPIIDKSTLAFLQ
YTSGSTGKPKGVMVSHGNLIHNSYYIQQACELTSKSISVTWLPSFHDMGLVDGILQPLYT
GFLGVVMSPTSFLGKPVRWLQAISDYKATHCGGPNFAYELCINKISSEQIKNIDLSSWRS
AYNGAEPIRRDTLKRFVEKFQVCGFRENSFYPCYGMAETTLMVSGNSVKDKPVYCSVAAD
SLFLNRVEKVSEKAENKINLVGCGHECLDTKIAIANPQTLASCAKNEVGEIWVSSDSVAQ
GYWKKPELTKETFQAYLSDTNQGPFLRTGDLGFLRDGELFVTGRIKDVIIIRGRNHYPQD
IELTVEKSHPALRVTCSAAFTVEVDGEERLVIAQEVERVYLRKLKVDEVLGAIRKAVSEQ
HQLQVYAVLLLRTGSIPKTSSGKIQRHACKIGFTENNLQVVGNWISQSSTIQSQSDDNSA
DSIQKWIKQWLSGKLQISSNLIDTQKSFAEYGLDSVMAVELAQDLKSKFNPEKELEATIA
WNFPNIDSLVLYLSKPIDTSSIAASNFNSNNLITTSSQQLKQVSGDEVKTAISHEVAQIE
DLLAELESLQRSN
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcaatggtcgaaaaatgactcaatttttaaatgtgtttcctgattctaccttg
gttgatattttgcaatacagagcaacgcatcaaccagataattgtgcatttatcttttta
caggatggagaaactcaagcggttaatctaacttacaaagaattagacagacaagcgcgg
gcgatcgcctttcatttgcaatcagtaaatgcggttgggagtcgtgctttactgctgtat
cctcctggattggaatttatcgctgcgtttttaggatgcttgtatgcgaaagtaatagct
gtaccagcttatcctcctcgacgcaatcagaaaattaataggttgcaagcaattgttaag
gatgctgaagcgacgttatgcttaacaactgcatcggagttggataatatccggaataaa
tttattcaagatccccaacttgctggtttgcaatatctggctacagatagccttattgag
aataatttaatagactggcacaaacccattatagataaaagtacattagcttttttgcaa
tacacttccggttctacgggaaaaccgaaaggtgtaatggttagtcatggtaatttaatt
cataattcatactacattcaacaagcttgtgaactaacatctaagagtatttctgtaact
tggttgcctagttttcatgatatggggctggtagatggaattctccaacctctgtatact
gggtttttgggtgttgtcatgtccccgacatcctttttaggtaaacctgtgagatggctg
caagcaatttctgactataaagcaactcattgtggtggtcccaattttgcctatgagctt
tgtataaataaaattagttcagagcaaattaaaaatatcgatttaagtagttggcgtagt
gcttacaacggagcagaaccaataaggcgggatactttaaagagatttgtcgagaaattt
caggtttgtggttttcgagaaaattctttttatccctgttatgggatggctgaaacaact
ttgatggtttcgggtaattctgtcaaggataaaccagtttattgctcggtagcagcggat
agtttatttttaaatcgagtagaaaaggtatctgaaaaagctgagaacaaaataaattta
gttgggtgcggacatgagtgtctggatactaaaattgccatagctaatccccaaactctt
gcaagttgtgcgaaaaatgaagttggggaaatttgggtatcgagcgatagtgtagctcaa
ggttattggaaaaaaccggagttaacgaaggaaacttttcaagcttatttaagcgatacc
aatcaaggtccatttttgcgtaccggagacttaggatttttgagagatggtgagttattt
gttaccgggcgtatcaaagatgtaattattattcgcggtcgcaatcattatcctcaagat
atagaattaactgtagaaaaaagtcatccggctttgagagtaacttgtagtgcagccttt
acagtagaagtggatggagaagaacggttagttattgcacaagaagtagagcgagtttac
ctgcggaaattaaaggtagatgaggtattaggagcgattcgcaaagctgtatcggagcag
catcagttacaagtttatgccgtgttattgctgagaacgggaagtattcccaaaacttct
agcggtaaaattcagcgacacgcttgtaagattgggtttactgaaaataatcttcaggtt
gtcggtaattggatatctcaatcttcaacaatacaatcgcaatctgatgataatagcgct
gattcaattcaaaaatggataaaacagtggttgagcggtaagttgcaaatatcttccaat
ttaatagatactcaaaaatcctttgctgaatacggtttggattcagtgatggctgtggaa
ttagctcaagatttgaaatctaagtttaaccccgaaaaagagttagaagcgactatagct
tggaattttccgaatatcgattctttagtgctgtacttgagcaaacccattgatactagt
tctatagcagcgagcaattttaattctaataatttgataacaacttcttcgcaacagttg
aaacaagtttccggagatgaagtaaaaactgcaattagtcacgaagttgcacaaatagaa
gacttgcttgcggaactagaaagcttgcaaaggagtaattga

DBGET integrated database retrieval system