KEGG   Roseburia intestinalis XB6B4: RO1_19910Help
Entry
RO1_19910         CDS       T02597                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
rix00440  Phosphonate and phosphinate metabolism
rix01100  Metabolic pathways
rix01120  Microbial metabolism in diverse environments
rix01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rix00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    RO1_19910
Enzymes [BR:rix01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     RO1_19910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like ComA BtpA
Motif
Other DBs
NCBI-ProteinID: CBL12533
UniProt: D4KYU3
LinkDB All DBs
Position
2006380..2007675
Genome map
AA seq 431 aa AA seqDB search
MKKVYLCMSTDIIQTGHINVIEKAAELGEVTVGVLSDKYVAMYEKYPILPLEERMRIIQN
IKGVSKVVVQNDIYYDEIIRELKPDIVIHGDNWTDGYQKAVRDRVIEVLAEWGGELIEIP
YYKSSNLHLFENAMSESRGLPEVRRQVLRRKICSGEVFKVMVAYDGLSALLVEKTSIEKD
GERRQFDGIWISSLCDSTAKGKPDIELVDLTSRLNSVNDIMEVTTKPIIFDADTGGLVEH
FVYNIKTLERMGVSAVIIEDKIGLKRNSLLGNDVEQHQDSIEHFCEKIREGKKAIGSSAF
MLIARIESLILDQGVDDALERAKAYVEAGADGIMIHSRAKSPDEIFEFADRFRETDKDTA
IVVVPTTYNQVRESEFKEHKINVVIYANHMLRAAFPAMQKVVTSVLENERCYEASQDCMS
IKDILSLVPVE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgtatttgtgtatgtccactgatattattcagacaggacatatcaatgta
atagaaaaagcagcggaacttggagaggtaaccgtcggagttttaagtgacaagtatgtt
gcaatgtatgagaaatatccgatacttccgttggaagaacgtatgaggatcattcagaat
atcaaaggtgtatcaaaggtcgttgtccagaatgatatctattatgatgagatcattcgg
gaattaaagccggatatcgtaatccacggagataactggaccgatggatatcagaaagcg
gtcagagatcgtgttattgaggtgttagctgagtggggtggcgaactgattgaaatccca
tattataaaagctcaaatctgcatctgtttgaaaatgcgatgagtgagagccgtggactt
ccagaggtaagaagacaggtattgcgccggaagatctgctcaggagaggtgtttaaagtc
atggtcgcatatgacggattgagcgcgctgctcgttgaaaaaacaagtattgaaaaggat
ggagaaagaagacagttcgacggcatctggatttcaagcctctgcgattctactgcaaag
ggaaaacctgacattgaactggtcgatctgacatccagacttaattccgtaaatgatatc
atggaagtaacaacaaaaccgatcattttcgatgcggatacgggcggactggtagaacat
tttgtctacaacatcaagacactggagcgtatgggtgtttccgcagtaattattgaggac
aagatcggattaaagagaaactccctgttgggcaatgatgtggaacagcatcaggacagc
atcgaacatttctgtgagaagatcagagaaggcaaaaaggcgatcggatcaagtgcgttt
atgctgatcgccagaatcgaaagcctgatactggatcagggagtagacgatgcgttagag
cgtgcaaaagcatatgtggaagcaggcgcggatggtattatgatccattcccgtgcaaag
tctccggatgagatcttcgaatttgcagaccgcttcagagaaacggataaagatacagca
atcgttgtggtaccgacgacatacaatcaggtaagagagagcgaatttaaggagcacaag
ataaatgtggttatttatgcaaaccatatgttacgggcagcatttccggcaatgcaaaaa
gtagtcacctctgttctggaaaatgagagatgctatgaggcaagtcaggactgcatgtcg
atcaaagacattttatctttggttccggtagaataa

DBGET integrated database retrieval system