KEGG   Roseburia intestinalis XB6B4: RO1_38160Help
Entry
RO1_38160         CDS       T02597                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rix  Roseburia intestinalis XB6B4
Pathway
rix00473  D-Alanine metabolism
rix00550  Peptidoglycan biosynthesis
rix01100  Metabolic pathways
rix01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rix00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RO1_38160
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RO1_38160
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RO1_38160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rix01011]
    RO1_38160
Enzymes [BR:rix01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RO1_38160
Peptidoglycan biosynthesis and degradation proteins [BR:rix01011]
 Precursor biosynthesis
  Amino acid ligase
   RO1_38160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 RimK GARS_A ATP-grasp ATPgrasp_ST ATPgrasp_Ter ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CBL14041
UniProt: D4L351
LinkDB All DBs
Position
3792616..3793671
Genome map
AA seq 351 aa AA seqDB search
MKIVVLAGGLSTERDVSFKTGDMVAKALRENGHQVILLDVFMGYSDKKEDLTGIFDRSEE
VSVKVSGIPEIAPDLAKVKASRKDQSDNFFGPNVIELCQMSDIVFMALHGENGENGKIQA
AFDLFGIRYTGTGYLSSALAMDKEMSKKLFLSAGIPAPKGASMKKADCSDDITKLGIQFP
CVVKPCCGGSSIGVSIAHNAEEYKAALDEAFRWEENLIVEEYVKGREFSVGVIEGKALPI
IEIAPVQGFYDYKNKYKAGSAVETCPAELSEAVTEKMQHYAEQVAQVLGLDTYSRTDFLL
DENENIYCLEANTLPGMTPTSLLPQEAQVVGVNFNELCEKLIQISLDKYEK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgttgttttagcaggtggtttaagtacagagagagatgtttcctttaagacc
ggagatatggtggcaaaggcattgagagagaatggacatcaggtaatcttacttgatgta
tttatgggatacagtgataaaaaagaagatctgacaggtatttttgaccggagtgaggaa
gtcagtgtaaaagtatccggaataccggaaattgcaccggatcttgcaaaggtaaaagca
tccagaaaagatcagtcagacaatttctttggaccgaatgtgatcgaattatgccagatg
tccgatatcgtttttatggcactgcatggagaaaacggagaaaacggcaagattcaggcc
gcatttgatctgtttggcatccgctatacaggaaccggttatttaagcagtgcgcttgcc
atggataaggagatgtccaaaaaattatttttgtcagcaggcataccggctccaaagggc
gcatccatgaaaaaggctgactgcagcgacgatatcacaaaacttggcattcagttcccg
tgtgtggtaaaaccatgctgcggaggttcgagtatcggtgtttccatcgcacacaatgcg
gaggaatataaagcagcattagatgaggcgttccgctgggaagaaaacctgatcgtggaa
gaatatgtaaaaggacgtgagttttctgtcggcgtgatcgagggaaaagcacttccgatc
atcgagatcgcaccggtacagggattttatgattataagaataaatacaaagcaggcagt
gctgttgagacctgtccggcagaactttcagaagctgttacagagaaaatgcagcattat
gcagagcaggtggcacaggtacttggattagatacctattcccgcaccgattttctgttg
gatgaaaatgaaaatatctactgtctggaagcaaacacattgccgggtatgactccgaca
agtcttcttccacaggaggcacaggttgtcggtgtgaactttaacgaattgtgtgagaaa
ctgatccagatttccctggataaatatgagaaataa

DBGET integrated database retrieval system