KEGG   Roseburia intestinalis XB6B4: RO1_39440Help
Entry
RO1_39440         CDS       T02597                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rix  Roseburia intestinalis XB6B4
Brite
KEGG Orthology (KO) [BR:rix00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rix01001]
    RO1_39440
Enzymes [BR:rix01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RO1_39440
Protein kinases [BR:rix01001]
 Serine/threonine kinases: Other
  Bacterial family
   RO1_39440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo ATG19_autophagy RIO1 Haspin_kinase EphA2_TM Pkinase_fungal OAD_gamma ODV-E18
Motif
Other DBs
NCBI-ProteinID: CBL14157
UniProt: D4L3G7
LinkDB All DBs
Position
3909748..3911859
Genome map
AA seq 703 aa AA seqDB search
MLTEGMYIADRYEILGKVGAGGMSDVYKAKDLTLGRFVAIKVLKAEFSEDINFVTKFRSE
AQAAAGLEHPNIVNIYDVGSENGLHYIVMEYVEGITLKTYIEKKGQLSFKEAVSIAIQVG
RGIEAAHNKNIVHRDIKPQNIMISTEGKVKVTDFGIARAATSNTISSDVMGSVHYSSPEQ
ARNGFVDGKSDIYSLGIVMYEMVTGRVPFDGDTTVAVAIQHLQEEIVPPSVYAPNLPISM
EKIILKCTQKNPDRRYASMTALLADLRKALISPNEDFVVMVPLANQDKTRVIGADDLNQI
KKQTANVYIDPASIKIQEPVIDDDDEDDDDDIDDEDGDINPKMEKAITIMGIAAGVVIII
IIIYLCITLAGGMKSNKNNSSNTETTKTETQTGDSQSTQIKDGVVVPSLTGKTMDQAKQE
LNGTGLGIRQAGTASSDTVEKGQIISQDPADGKTVEKNTTIEVIISSGSAAGTSENTVEI
PNVVGQSETDASAALTAKGFQVTKTTSYSSSVAEGYVISQTPNGDTQGKEGDTITLEISL
GSEKITVPDVSTSYKSEEQAKELLSQFNVSTVTKYSDTDAGIVIGQSLAVGTQADPGASI
TITVSLGPEPAQQITTKTYKLNVSLQLPSDTSNISGADIVLYDDQGNVLQTWYGKTIADF
GTGGLILTKTGILSDSGKIVVTWLDLNGNDLKDQTIDVQFQEE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgttgacagaaggtatgtacatagcagaccgctatgaaattttaggtaaagttggcgct
ggcggaatgtcagatgtatataaagcaaaagatcttacactgggaagatttgtagcaatc
aaggtattaaaggcagaattttccgaggatattaatttcgtaacgaaattccgttccgag
gcacaggcagctgcagggttagagcacccgaatattgtaaatatttatgatgtcggcagt
gagaatggcctgcattatatcgtgatggaatatgtggaaggaatcacattaaagacctac
attgagaaaaaaggacagctttcttttaaggaggcagtcagcatcgcaattcaggtgggc
agaggtattgaagccgcccataataaaaatatcgtgcatcgtgatatcaaaccgcagaat
atcatgatctccacagagggaaaagtaaaagtaacagattttggtattgcgcgggcagca
acatcaaatacgatcagttcggatgtgatgggatccgtacattattcttctccggaacag
gcgagaaatggatttgtggatggcaagagtgatatctattcactgggtatcgtgatgtat
gagatggtaacaggccgtgttccgtttgacggggatacgacggtcgcagttgcaatccag
catctgcaggaagagatagtaccgccaagtgtttatgcaccaaatcttccaatcagtatg
gaaaagatcatcttaaaatgtacacagaaaaaccctgacagaagatatgcttccatgaca
gcgcttctggccgatcttagaaaagcactgatcagcccgaacgaggattttgttgtgatg
gtacctcttgcaaatcaggataagacgagggtgatcggagcagatgatttaaatcagatc
aagaaacagactgcaaacgtctatatagatccggcgtcgatcaaaatacaggagccggtg
atcgatgatgatgacgaggacgacgatgatgatattgatgacgaggatggtgatatcaat
ccgaagatggaaaaggcaatcacgatcatgggaatcgcagcaggtgtagtgatcattatc
atcattatttacctgtgcatcacgttagccgggggtatgaagtctaacaagaacaattct
tcgaatacagaaacaacaaaaacggaaacacagacgggagacagtcagagtacccagatc
aaggacggtgtagtagtaccttccctgacaggaaaaaccatggatcaggcaaaacaggag
ttaaacggaaccggactcggcatcagacaggctggaaccgcatcctctgataccgtagaa
aagggacagatcataagccaggatccggcagatggtaagactgttgaaaagaatacaacg
atcgaagttatcatcagcagcggatctgccgccggaaccagtgagaatacggtcgaaata
ccaaacgttgtgggacagagtgagacagatgccagcgcggcattgacggcaaagggattt
caggtcacaaagacaacttcctacagttcctccgttgcggaaggatatgtaatttcccag
acaccaaatggggatacccagggaaaagagggcgatacgatcacacttgagatcagcctt
ggctcagagaagattacagtacctgatgtatcgacaagctataagtcagaggaacaggcg
aaagaacttttatcacagtttaatgtttcaacggtcacaaaatacagtgatacggatgcc
ggaatcgtaatcggacagtcacttgcggtgggaacacaggcagatccgggagcatccatc
acgatcacagtcagtcttggaccggaaccggcacagcagatcaccacaaagacttataag
ctgaatgtcagcctgcagcttccatcagatacatcgaatatctccggtgcagacattgtt
ttatatgatgatcagggcaatgttttacagacctggtacggcaaaacgattgcagatttt
ggtactggcggactgattctgacaaagaccggtattctttcggacagtggtaaaatcgta
gttacctggctggacttaaatggaaatgatttaaaagaccagacgattgatgtacagttc
caggaagaataa

DBGET integrated database retrieval system