KEGG   Rickettsia japonica: RJP_0420Help
Entry
RJP_0420          CDS       T01637                                 

Gene name
dacF
Definition
(GenBank) penicillin-binding protein dacF precursor
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
rja  Rickettsia japonica
Pathway
rja00550  Peptidoglycan biosynthesis
rja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RJP_0420 (dacF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rja01002]
    RJP_0420 (dacF)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rja01011]
    RJP_0420 (dacF)
Enzymes [BR:rja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RJP_0420 (dacF)
Peptidases and inhibitors [BR:rja01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   RJP_0420 (dacF)
Peptidoglycan biosynthesis and degradation proteins [BR:rja01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   RJP_0420 (dacF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13 CytoC_RC
Motif
Other DBs
NCBI-ProteinID: BAK96634
UniProt: G4KMX6
LinkDB All DBs
Position
535506..536426
Genome map
AA seq 306 aa AA seqDB search
MFRKFLLPYVFVVTFFFAPISEAKKAVKNTPKPPVQTSLVIDAKSGKVLQAHNSQIRIYP
ASLTKLMTLYLMFEAIEAGKLPLDKKLLVSAKASKMPPCKLGLKAGETITVREAINGLII
KSANDVAVTVAEGMKGSEKAFAHLMNVKAKQLGMKNTYFKNASGWHDPLQQTTARDMAKL
AMALKRDYPKFYPLFAKTSFVFRGNVVNGHNRVTKNYQGAEGMKTGFHTPAGYNLVTTAS
RNGKSLIAVVTGGKSAASRDQKMMGLLDQHFNIKPIVPKPSIKLASNNKSTTKAKSKIIK
KKNMRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggaaatttttattaccttatgtttttgtcgtaacatttttctttgcacctata
agcgaagcaaaaaaagccgtaaaaaatacccctaaacctcctgttcaaactagtttagta
attgatgcaaaaagcggtaaagtgttgcaggcccataattcacaaattcggatttacccc
gcttctttaactaagctaatgactctatacttaatgtttgaagcaattgaagccggtaag
ttacctttagataaaaaattacttgtatcagcaaaagcttcaaaaatgccgccttgtaag
ctgggtttaaaagcaggggaaactataaccgttcgagaggcaattaatggattaattata
aaatctgctaatgatgttgctgtaacggttgctgagggcatgaaaggttcagagaaagct
tttgctcatttaatgaatgttaaagctaaacagctcggtatgaagaatacctattttaaa
aatgcttcaggttggcatgacccattgcagcaaactaccgcaagagatatggctaaactt
gctatggctttgaagagagattatcctaaattttatccgttatttgctaaaaccagcttt
gtatttcgtggaaacgtagtaaacggacataatagggttactaaaaattatcaaggtgca
gaagggatgaaaacaggttttcatacaccggcaggttataatttagtaactactgcttct
aggaacggtaaatcattgattgccgttgttacaggcggtaaaagtgccgcatctcgtgat
caaaagatgatggggctactagatcagcattttaatattaagcctatagtccctaaacct
tcaatcaagcttgcctctaataataaatctactacaaaagctaaatcaaaaataataaag
aaaaagaatatgcgtagttga

DBGET integrated database retrieval system