KEGG   Rhizobium jaguaris: CCGE525_06000Help
Entry
CCGE525_06000     CDS       T05891                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rjg01100  Metabolic pathways
rjg01110  Biosynthesis of secondary metabolites
rjg01130  Biosynthesis of antibiotics
rjg01230  Biosynthesis of amino acids
rjg02024  Quorum sensing
Module
rjg_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCGE525_06000
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CCGE525_06000
Enzymes [BR:rjg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CCGE525_06000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DUF4893
Motif
Other DBs
NCBI-ProteinID: AYG58413
UniProt: A0A387FJC1
LinkDB All DBs
Position
complement(1229993..1231057)
Genome map
AA seq 354 aa AA seqDB search
MLKSTDDLRIVEITALTPPSRIIEEIPRDEAITTTVTETRNAVHGILHNDDDRLIVVIGP
CSIHDPVAARDYAARLKEQRDRFADDLEIIMRVYFEKPRTTVGWKGLINDPHLDGSYRIE
EGLRIARSLLVDVNEIGLPAGCEYLDTITPQYISDLVSWGAIGARTTESQVHRQLASGLS
CPVGFKNGTNGDAKIALDAIVAASQPHHFPAVTKDGLAAIASTRGNDDCHLILRGGKQPN
YDAASVQAVSAQAQKTGLDPRIIIDASHANSGKDPENQPMVVSSVAEQISAGDRRIKGMM
MESNIVGGRQDLVPGKALVYGQSITDGCIDWPTSVRTLEELARAAQTRRRMPRQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaaatccactgatgatttgcgaattgtcgagattactgccctgacgccgccctcc
cgcattatagaggagatcccgcgggacgaggccattaccacgaccgtgacggaaactcgc
aatgccgttcacggcatcctgcacaatgacgatgatcgattgatcgtggttatcggcccc
tgctccatccacgatcccgtcgcggcacgtgactacgccgctcgcctgaaggaacagcgc
gaccggttcgccgacgatctcgaaatcatcatgcgggtctatttcgagaagcctcgaacc
acggtcggctggaagggcctcatcaacgatccccatctcgacggaagctaccgcatcgaa
gaggggttgcgtatcgccagaagtcttctggttgacgtcaacgaaatagggctgccggcc
ggttgcgaatacctcgacacgatcacgccgcagtacatttccgatttggtgagctggggc
gcaatcggtgcaaggacgaccgagagccaggtgcatcgtcagctcgcttcgggcctttca
tgccctgtcggtttcaagaacggaacgaatggcgatgcaaagatagctctggatgcgatc
gtggcagcctcgcagccgcatcattttccggcagtgaccaaggatggccttgcggccatt
gcctcgacacgcggcaacgacgattgccatctcattctgcgcggcggcaagcaacccaac
tatgacgcggccagtgtgcaggcggtatcggcacaggctcagaaaacggggcttgatccg
cggatcatcatcgatgccagccatgccaacagcggcaaggaccctgagaaccagccaatg
gtcgtcagctccgtcgcagaacaaatatctgccggcgaccgtcgcatcaaaggcatgatg
atggagagcaacatcgtcggcggccgccaggatctcgttcccggcaaagcactggtctat
ggccaaagcatcaccgacggctgcattgattggccgacttccgtccggacattggaggaa
ctggcccgagctgcacaaacaagacggcggatgcctcgccaatag

DBGET integrated database retrieval system