KEGG   Rhizobium jaguaris: CCGE525_09885Help
Entry
CCGE525_09885     CDS       T05891                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rjg  Rhizobium jaguaris
Pathway
rjg00010  Glycolysis / Gluconeogenesis
rjg00020  Citrate cycle (TCA cycle)
rjg00620  Pyruvate metabolism
rjg01100  Metabolic pathways
rjg01110  Biosynthesis of secondary metabolites
rjg01120  Microbial metabolism in diverse environments
rjg01130  Biosynthesis of antibiotics
rjg01200  Carbon metabolism
Module
rjg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rjg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCGE525_09885
   00020 Citrate cycle (TCA cycle)
    CCGE525_09885
   00620 Pyruvate metabolism
    CCGE525_09885
Enzymes [BR:rjg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CCGE525_09885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 DUF2118 QRPTase_N HlyD_2
Motif
Other DBs
NCBI-ProteinID: AYG59070
UniProt: A0A387FIC4
LinkDB All DBs
Position
2010586..2011953
Genome map
AA seq 455 aa AA seqDB search
MPINITMPALSPTMEEGNLAKWLVKEGDKIKSGDVIAEIETDKATMEVEAVDEGTVAKIV
VPAGTEGVKVNALIAVLAGEGEDVSAAALGAAAAAPAAAAAPAAAAPAPKAETAPAQSAP
AAQPAPVAPAALSTDGHRTFASPLARRLAKESGIDLAALVGSGPHGRVIKKDIEAAVAGG
GVAKAAPAAAPASQPAAAVQAPAAAAPKGMSEDAVLKLFEPGSYELVPHDGMRKTIAKRL
QESKQTVPHFYVTVDCELDALLALRTQLNDAAQKSKDGVPAYKLSVNDMVIKALALALRD
VPDANVSWTDNNMVKHKHADVGVAVSIPGGLITPIIRSAELKTLSAISNEMKDYGKRAKE
RKLKPEEYQGGTTAVSNMGMMGVKNFSAVINPPHATILAVGAGEQRVIVKKGEMAIATMM
SVTLSTDHRCVDGALGAELLAAFKGYIENPMGMLV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcaacatcaccatgcctgccctctcgccgaccatggaagagggcaacctcgcc
aagtggctggtcaaggaaggcgataagatcaagtccggcgacgtcatcgccgagatcgag
accgacaaggcaacgatggaagtcgaagctgtcgacgagggcaccgtcgccaagatcgtc
gttccggccggcaccgaaggcgtcaaggtcaatgcgctgatcgcggttctggccggggaa
ggcgaggacgtttccgccgctgccttgggtgctgctgctgctgcgcctgccgctgctgct
gcgcctgccgctgcggcgcctgcgccgaaggcggagacggctccggctcaatccgcgccg
gctgcacagcccgcgccagttgcgccagcggccctctcgacggatggtcatcgcaccttc
gcctcgccgctcgctcgccgtcttgccaaggaatccggcatcgatctggccgcgctcgtc
ggctccggtccgcatggccgggtgatcaagaaggacatcgaagccgctgttgccggtggt
ggcgttgcaaaggccgctccggcggctgcccccgcttcgcagccggccgccgctgttcag
gctccggcggcagccgcgccgaagggcatgtcggaagatgccgttctcaagctgttcgag
cccggttcctacgagctcgtgccgcatgacggcatgcgcaagaccattgccaagcgcctg
caggaatccaagcagaccgttccgcatttctacgtcaccgtcgattgcgagctggacgca
ctgttggcgctgcgcacgcagctcaacgatgctgctcagaagtcgaaggatggcgttccg
gcctataagctctccgtcaatgacatggtcatcaaggcgctggcgctggcgctgcgcgat
gtgccggatgccaacgtctcctggaccgacaacaacatggtcaagcacaagcacgccgat
gtcggcgtcgccgtctccattccgggcggtctgatcacgccgatcatccgcagcgccgag
ttgaagacgctgtcggccatctccaatgagatgaaggactacggcaagcgcgccaaggag
cgcaagctgaagcccgaggaatatcagggcggcaccactgctgtgtccaatatgggcatg
atgggcgtcaagaacttctccgctgttatcaacccgccgcatgcgaccattctcgccgtt
ggcgcgggtgagcagcgtgtgatcgtcaaaaagggtgaaatggccatcgccaccatgatg
agcgtcacgctgtcgaccgaccatcgctgtgtcgacggtgcgcttggcgcggaacttctg
gcagccttcaagggctacatcgaaaacccgatggggatgctcgtctga

DBGET integrated database retrieval system